Chitinase A

Details

Name
Chitinase A
Synonyms
  • 3.2.1.14
Gene Name
chiA
Organism
Serratia marcescens
Amino acid sequence
>lcl|BSEQ0016505|Chitinase A
MRKFNKPLLALLIGSTLCSAAQAAAPGKPTIAWGNTKFAIVEVDQAATAYNNLVKVKNAA
DVSVSWNLWNGDAGTTAKILLNGKEAWSGPSTGSSGTANFKVNKGGRYQMQVALCNADGC
TASDATEIVVADTDGSHLAPLKEPLLEKNKPYKQNSGKVVGSYFVEWGVYGRNFTVDKIP
AQNLTHLLYGFIPICGGNGINDSLKEIEGSFQALQRSCQGREDFKVSIHDPFAALQKAQK
GVTAWDDPYKGNFGQLMALKQAHPDLKILPSIGGWTLSDPFFFMGDKVKRDRFVGSVKEF
LQTWKFFDGVDIDWEFPGGKGANPNLGSPQDGETYVLLMKELRAMLDQLSAETGRKYELT
SAISAGKDKIDKVAYNVAQNSMDHIFLMSYDFYGPFDLKNLGHQTALNAPAWKPDTAYTT
VNGVNALLAQGVKPGKVVVGTAMYGRGWTGVNGYQNNIPFTGTATGPVKGTWKNGIVDYR
QIAGQFMSGEWQYTYDATAEAPYVFKPSTGDLITFDDARSVQAKGKYVLDKQLGGLFSWE
IDADNGDILNSMNASLGNSAGVQ
Number of residues
563
Molecular Weight
60978.56
Theoretical pI
7.48
GO Classification
Functions
chitinase activity
Processes
chitin catabolic process / polysaccharide catabolic process
General Function
Chitinase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0003270|1689 bp
ATGCGCAAATTTAATAAACCGCTGTTGGCGCTGTTGATCGGCAGCACGCTGTGTTCCGCG
GCGCAGGCCGCCGCGCCGGGCAAGCCGACCATCGCCTGGGGCAACACCAAGTTCGCCATC
GTTGAAGTTGACCAGGCGGCTACCGCTTATAATAATTTGGTGAAGGTAAAAAATGCCGCC
GATGTTTCCGTCTCCTGGAATTTATGGAATGGCGACGCGGGCACGACGGCCAAGATTTTA
TTAAATGGTAAAGAGGCGTGGAGTGGTCCTTCAACCGGATCTTCCGGTACGGCGAATTTT
AAAGTGAATAAAGGCGGCCGTTATCAAATGCAGGTGGCATTGTGCAATGCCGACGGCTGC
ACCGCCAGTGACGCCACCGAAATTGTGGTGGCCGACACCGACGGCAGCCATTTGGCGCCG
TTGAAAGAGCCGCTGCTGGAAAAGAATAAACCGTATAAACAGAACTCCGGCAAAGTGGTC
GGTTCTTATTTCGTCGAGTGGGGCGTTTACGGGCGCAATTTCACCGTCGACAAGATCCCG
GCGCAAAACCTGACCCACCTGCTGTACGGCTTTATCCCGATCTGCGGCGGCAATGGCATC
AACGACAGCCTGAAAGAGATTGAAGGCAGCTTCCAGGCGTTACAGCGCTCCTGCCAGGGC
CGCGAGGACTTCAAAGTCTCGATCCACGATCCGTTCGCCGCGCTGCAAAAAGCGCAGAAG
GGCGTGACCGCCTGGGATGACCCCTACAAGGGCAACTTCGGCCAGCTGATGGCGCTGAAG
CAGGCGCATCCTGACCTGAAAATCCTGCCGTCGATCGGCGGCTGGACGCTGTCCGACCCG
TTCTTCTTCATGGGCGACAAGGTGAAGCGCGATCGCTTCGTCGGTTCGGTGAAAGAGTTC
CTGCAGACCTGGAAGTTCTTCGACGGCGTGGATATCGACTGGGAGTTCCCGGGCGGCAAA
GGCGCCAACCCTAACCTGGGCAGCCCGCAAGACGGGGAAACCTATGTGTTGCTGATGAAG
GAGCTGCGGGCGATGCTGGATCAGCTGTCGGCGGAAACCGGCCGCAAGTATGAGCTGACC
TCCGCCATCAGCGCCGGTAAGGACAAGATCGACAAGGTGGCTTACAACGTTGCGCAGAAC
TCGATGGATCACATCTTCCTGATGAGCTACGACTTCTATGGCGCCTTCGATCTGAAGAAC
CTGGGGCATCAGACCGCGCTGAATGCGCGGCCTGGAAGCCGACACCGCTTACACCACGGT
GAACGGCGTCAATGCGCTGCTGGCCAGGGCGTCAAGCCGGGGAAAGTCGTCGTCGGCACC
GCCATGTATGGCCGCGGCTGGACCGGGGTGAACGGCTACCAGAACAACATTCCGTTCACC
GGTACCGCCACTGGGCCGGTTAAAGGCACCTGGAAGAACGGCATCGTGGACTACCGCCAA
ATCGCCGGCCAGTTCATGAGCGGCGAGTGGCAGTATACCTACGACGCCACGGCGGAAGCG
CCTTACGTGTTCAAACCTTCCACCGGCGATCTGATCACCTTCGACGATGCCCGCTCGGTG
CAGGCCAAAGGCAAGTACGTGCTGGATAAGCAGCTGGGCGGCCTGTTCTCCTGGGAGATC
GACGCGGATAACGGCGATATTCTCAACAGCATGAACGCCAGCCTGGGCAACAGCGCCGGC
GTTCAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP07254
UniProtKB Entry NameCHIA_SERMA
GenBank Protein ID152818
GenBank Gene IDL01455
General References
  1. Jones JD, Grady KL, Suslow TV, Bedbrook JR: Isolation and characterization of genes encoding two chitinase enzymes from Serratia marcescens. EMBO J. 1986 Mar;5(3):467-73. [PubMed:16453672]
  2. Brurberg MB, Eijsink VG, Nes IF: Characterization of a chitinase gene (chiA) from Serratia marcescens BJL200 and one-step purification of the gene product. FEMS Microbiol Lett. 1994 Dec 15;124(3):399-404. [PubMed:7851747]
  3. Perrakis A, Tews I, Dauter Z, Oppenheim AB, Chet I, Wilson KS, Vorgias CE: Crystal structure of a bacterial chitinase at 2.3 A resolution. Structure. 1994 Dec 15;2(12):1169-80. [PubMed:7704527]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03109N-Acetyl-D-AllosamineexperimentalunknownDetails
DB04404AllosamizolineexperimentalunknownDetails
DB04628AllosamidinexperimentalunknownDetails