Complement component C8 alpha chain

Details

Name
Complement component C8 alpha chain
Synonyms
  • Complement component 8 subunit alpha
Gene Name
C8A
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049856|Complement component C8 alpha chain
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRH
RSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQD
CLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETV
YNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKV
KKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAH
FKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKA
KMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDII
SRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKR
QNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADG
SWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC
Number of residues
584
Molecular Weight
65162.685
Theoretical pI
Not Available
GO Classification
Functions
complement binding / protein complex binding
Processes
complement activation / complement activation, alternative pathway / complement activation, classical pathway / cytolysis / immune response / regulation of complement activation
Components
blood microparticle / extracellular exosome / extracellular region / extracellular space / membrane / membrane attack complex
General Function
Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C8A inserts into the target membrane, but does not form pores by itself.
Specific Function
Complement binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0049857|Complement component C8 alpha chain (C8A)
ATGTTTGCTGTTGTTTTCTTCATCTTGTCTTTGATGACTTGTCAGCCTGGGGTAACTGCA
CAGGAGAAGGTGAACCAGAGAGTAAGACGGGCAGCTACACCCGCAGCAGTTACCTGCCAG
CTGAGCAACTGGTCAGAGTGGACAGATTGCTTTCCGTGCCAGGACAAAAAGTACCGACAC
CGGAGCCTCTTGCAGCCAAACAAGTTTGGGGGAACCATCTGCAGTGGTGACATCTGGGAT
CAAGCCAGCTGCTCCAGTTCTACAACTTGTGTAAGGCAAGCACAGTGTGGACAGGATTTC
CAGTGTAAGGAGACAGGTCGCTGCCTGAAACGCCACCTTGTGTGTAATGGAGACCAGGAC
TGCCTTGATGGCTCTGATGAGGACGACTGTGAAGATGTCAGGGCCATTGACGAAGACTGC
AGCCAGTATGAACCAATTCCAGGATCACAGAAGGCAGCCTTGGGGTACAATATCCTGACC
CAGGAAGATGCTCAGAGTGTGTACGATGCCAGTTATTATGGGGGCCAGTGTGAGACGGTA
TACAATGGGGAATGGAGGGAGCTTCGATATGACTCCACCTGTGAACGTCTCTACTATGGA
GATGATGAGAAATACTTTCGGAAACCCTACAACTTTCTGAAGTACCACTTTGAAGCCCTG
GCAGATACTGGAATCTCCTCAGAGTTTTATGATAATGCAAATGACCTTCTTTCCAAAGTT
AAAAAAGACAAGTCTGACTCATTTGGAGTGACCATCGGCATAGGCCCAGCCGGCAGCCCT
TTATTGGTGGGTGTAGGTGTATCCCACTCACAAGACACTTCATTCTTGAACGAATTAAAC
AAGTATAATGAGAAGAAATTCATTTTCACAAGAATCTTCACAAAGGTGCAGACTGCACAT
TTTAAGATGAGGAAGGATGACATTATGCTGGATGAAGGAATGCTGCAGTCATTAATGGAG
CTTCCAGATCAGTACAATTATGGCATGTATGCCAAGTTCATCAATGACTATGGCACCCAT
TACATCACATCTGGATCCATGGGTGGCATTTATGAATATATCCTGGTGATTGACAAAGCA
AAAATGGAATCCCTTGGTATTACCAGCAGAGATATCACGACATGTTTTGGAGGCTCCTTG
GGCATTCAATATGAAGACAAAATAAATGTTGGTGGAGGTTTATCAGGAGACCATTGTAAA
AAATTTGGAGGTGGCAAAACTGAAAGGGCCAGGAAGGCCATGGCTGTGGAAGACATTATT
TCTCGGGTGCGAGGTGGCAGTTCTGGCTGGAGCGGTGGCTTGGCACAGAACAGGAGCACC
ATTACATACCGTTCCTGGGGGAGGTCATTAAAGTATAATCCTGTTGTTATCGATTTTGAG
ATGCAGCCTATCCACGAGGTGCTGCGGCACACAAGCCTGGGGCCTCTGGAGGCCAAGCGC
CAGAACCTGCGCCGCGCCTTGGACCAGTATCTGATGGAATTCAATGCCTGCCGATGTGGG
CCTTGCTTCAACAATGGGGTGCCCATCCTCGAGGGCACCAGCTGCAGGTGCCAGTGCCGC
CTGGGTAGCTTGGGTGCTGCCTGTGAGCAAACACAGACAGAAGGAGCCAAAGCAGATGGG
AGCTGGAGTTGCTGGAGCTCCTGGTCTGTATGCAGAGCAGGCATCCAGGAAAGGAGAAGA
GAGTGTGACAATCCAGCACCTCAGAATGGAGGGGCCTCGTGTCCAGGGCGGAAAGTACAG
ACGCAGGCTTGCTGA
Chromosome Location
1
Locus
1p32.2
External Identifiers
ResourceLink
UniProtKB IDP07357
UniProtKB Entry NameCO8A_HUMAN
HGNC IDHGNC:1352
General References
  1. Rao AG, Howard OM, Ng SC, Whitehead AS, Colten HR, Sodetz JM: Complementary DNA and derived amino acid sequence of the alpha subunit of human complement protein C8: evidence for the existence of a separate alpha subunit messenger RNA. Biochemistry. 1987 Jun 16;26(12):3556-64. [PubMed:2820471]
  2. Michelotti GA, Snider JV, Sodetz JM: Genomic organization of human complement protein C8 alpha and further examination of its linkage to C8 beta. Hum Genet. 1995 May;95(5):513-8. [PubMed:7759071]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Steckel EW, York RG, Monahan JB, Sodetz JM: The eighth component of human complement. Purification and physicochemical characterization of its unusual subunit structure. J Biol Chem. 1980 Dec 25;255(24):11997-2005. [PubMed:7440581]
  6. Hofsteenge J, Blommers M, Hess D, Furmanek A, Miroshnichenko O: The four terminal components of the complement system are C-mannosylated on multiple tryptophan residues. J Biol Chem. 1999 Nov 12;274(46):32786-94. [PubMed:10551839]
  7. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952]
  8. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218]
  9. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  10. Hadders MA, Beringer DX, Gros P: Structure of C8alpha-MACPF reveals mechanism of membrane attack in complement immune defense. Science. 2007 Sep 14;317(5844):1552-4. [PubMed:17872444]
  11. Slade DJ, Lovelace LL, Chruszcz M, Minor W, Lebioda L, Sodetz JM: Crystal structure of the MACPF domain of human complement protein C8 alpha in complex with the C8 gamma subunit. J Mol Biol. 2008 May 30;379(2):331-42. doi: 10.1016/j.jmb.2008.03.061. Epub 2008 Apr 3. [PubMed:18440555]
  12. Lovelace LL, Chiswell B, Slade DJ, Sodetz JM, Lebioda L: Crystal structure of complement protein C8gamma in complex with a peptide containing the C8gamma binding site on C8alpha: implications for C8gamma ligand binding. Mol Immunol. 2008 Feb;45(3):750-6. Epub 2007 Aug 9. [PubMed:17692377]
  13. Zhang L, Rittner C, Sodetz JM, Schneider PM, Kaufmann T: The eighth component of human complement: molecular basis of C8A (C81) polymorphism. Hum Genet. 1995 Sep;96(3):281-4. [PubMed:7649542]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails