Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase

Details

Name
Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
Synonyms
  • 2.1.1.57
  • PAP-S
  • Poly(A) polymerase regulatory subunit
  • Poly(A) polymerase small subunit
  • VP39
Gene Name
PAPS
Organism
VACV
Amino acid sequence
>lcl|BSEQ0019110|Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILD
GATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEY
LRSIKKQLHPSKIILISDVRSKRGGNEPSTADLLSNYALQNVMISILNPVASSLKWRCPF
PDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLN
KIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIPTTS
TEKVSHEPIQRKISSKNSMSKNRNSKRSVRSNK
Number of residues
333
Molecular Weight
38887.65
Theoretical pI
9.94
GO Classification
Functions
mRNA (nucleoside-2'-O-)-methyltransferase activity / translation elongation factor activity
Processes
7-methylguanosine mRNA capping / regulation of mRNA 3'-end processing / transcription, DNA-templated
Components
virion
General Function
Translation elongation factor activity
Specific Function
Displays methyltransferase, positive regulation of the poly(A) polymerase and transcription elongation activities. Involved in the modification of both mRNA ends and in intermediate and late gene positive transcription elongation. At the mRNAs 5' end, methylates the ribose 2' OH group of the first transcribed nucleotide, thereby producing a 2'-O-methylpurine cap. At the 3' end, functions as a processivity factor which stimulates the activity of the viral poly(A) polymerase VP55 that creates mRNA's poly(A) tail. In the presence of VP39, VP55 does not dissociate from the RNA allowing tail elongation to around 250 adenylates.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Virion
Gene sequence
>lcl|BSEQ0019111|Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase (PAPS)
ATGGATGTTGTGTCGTTAGATAAACCGTTTATGTATTTTGAGGAAATTGATAATGAGTTA
GATTACGAACCAGAAAGTGCAAATGAGGTCGCAAAAAAACTGCCGTATCAAGGACAGTTA
AAACTATTACTAGGAGAATTATTTTTTCTTAGTAAGTTACAGCGACACGGTATATTAGAT
GGTGCCACCGTAGTGTATATAGGATCTGCTCCCGGTACACATATACGTTATTTGAGAGAT
CATTTCTATAATTTAGGAGTGATCATCAAATGGATGCTAATTGACGGCCGCCATCATGAT
CCTATTTTAAATGGATTGCGTGATGTGACTCTAGTGACTCGGTTCGTTGATGAGGAATAT
CTACGATCCATCAAAAAACAACTGCATCCTTCTAAGATTATTTTAATTTCTGATGTGAGA
TCCAAACGAGGAGGAAATGAACCTAGTACGGCGGATTTACTAAGTAATTACGCTCTACAA
AATGTCATGATTAGTATTTTAAACCCCGTGGCGTCTAGTCTTAAATGGAGATGCCCGTTT
CCAGATCAATGGATCAAGGACTTTTATATCCCACACGGTAATAAAATGTTACAACCTTTT
GCTCCTTCATATTCAGCTGAAATGAGATTATTAAGTATTTATACCGGTGAGAACATGAGA
CTGACTCGAGTTACCAAATCAGACGCTGTAAATTATGAAAAAAAGATGTACTACCTTAAT
AAGATCGTCCGTAACAAAGTAGTTGTTAACTTTGATTATCCTAATCAGGAATATGACTAT
TTTCACATGTACTTTATGCTGAGGACCGTGTACTGCAATAAAACATTTCCTACTACTAAA
GCAAAGGTACTATTTCTACAACAATCTATATTTCGTTTCTTAAATATTCCAACAACATCA
ACTGAAAAAGTTAGTCATGAACCAATACAACGTAAAATATCTAGCAAAAATTCTATGTCT
AAAAACAGAAATAGCAAGAGATCCGTACGCAGTAATAAATAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP07617
UniProtKB Entry NameMCE_VACCW
GenBank Protein ID61396
GenBank Gene IDX01978
General References
  1. Plucienniczak A, Schroeder E, Zettlmeissl G, Streeck RE: Nucleotide sequence of a cluster of early and late genes in a conserved segment of the vaccinia virus genome. Nucleic Acids Res. 1985 Feb 11;13(3):985-98. [PubMed:2987815]
  2. Schnierle BS, Gershon PD, Moss B: Cap-specific mRNA (nucleoside-O2'-)-methyltransferase and poly(A) polymerase stimulatory activities of vaccinia virus are mediated by a single protein. Proc Natl Acad Sci U S A. 1992 Apr 1;89(7):2897-901. [PubMed:1313572]
  3. Gershon PD, Ahn BY, Garfield M, Moss B: Poly(A) polymerase and a dissociable polyadenylation stimulatory factor encoded by vaccinia virus. Cell. 1991 Sep 20;66(6):1269-78. [PubMed:1670500]
  4. Mohamed MR, Latner DR, Condit RC, Niles EG: Interaction between the J3R subunit of vaccinia virus poly(A) polymerase and the H4L subunit of the viral RNA polymerase. Virology. 2001 Feb 1;280(1):143-52. [PubMed:11162828]
  5. Oguro A, Johnson L, Gershon PD: Path of an RNA ligand around the surface of the vaccinia VP39 subunit of its cognate VP39-VP55 protein heterodimer. Chem Biol. 2002 Jun;9(6):679-90. [PubMed:12079779]
  6. Latner DR, Thompson JM, Gershon PD, Storrs C, Condit RC: The positive transcription elongation factor activity of the vaccinia virus J3 protein is independent from its (nucleoside-2'-O-) methyltransferase and poly(A) polymerase stimulatory functions. Virology. 2002 Sep 15;301(1):64-80. [PubMed:12359447]
  7. Li C, Xia Y, Gao X, Gershon PD: Mechanism of RNA 2'-O-methylation: evidence that the catalytic lysine acts to steer rather than deprotonate the target nucleophile. Biochemistry. 2004 May 18;43(19):5680-7. [PubMed:15134442]
  8. Hodel AE, Gershon PD, Shi X, Quiocho FA: The 1.85 A structure of vaccinia protein VP39: a bifunctional enzyme that participates in the modification of both mRNA ends. Cell. 1996 Apr 19;85(2):247-56. [PubMed:8612277]
  9. Hodel AE, Gershon PD, Shi X, Wang SM, Quiocho FA: Specific protein recognition of an mRNA cap through its alkylated base. Nat Struct Biol. 1997 May;4(5):350-4. [PubMed:9145102]
  10. Hodel AE, Gershon PD, Quiocho FA: Structural basis for sequence-nonspecific recognition of 5'-capped mRNA by a cap-modifying enzyme. Mol Cell. 1998 Feb;1(3):443-7. [PubMed:9660928]
  11. Hu G, Gershon PD, Hodel AE, Quiocho FA: mRNA cap recognition: dominant role of enhanced stacking interactions between methylated bases and protein aromatic side chains. Proc Natl Acad Sci U S A. 1999 Jun 22;96(13):7149-54. [PubMed:10377383]
  12. Hu G, Oguro A, Li C, Gershon PD, Quiocho FA: The "cap-binding slot" of an mRNA cap-binding protein: quantitative effects of aromatic side chain choice in the double-stacking sandwich with cap. Biochemistry. 2002 Jun 18;41(24):7677-87. [PubMed:12056899]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails
DB019607n-Methyl-8-Hydroguanosine-5'-DiphosphateexperimentalunknownDetails
DB019787,9-DimethylguanineexperimentalunknownDetails
DB031646-Amino-1-MethylpurineexperimentalunknownDetails
DB033587n-Methyl-8-Hydroguanosine-5'-TriphosphateexperimentalunknownDetails
DB034937-MethylguanosineexperimentalunknownDetails
DB041033-MethylcytosineexperimentalunknownDetails
DB043141-MethylcytosineexperimentalunknownDetails