Chemotaxis protein methyltransferase

Details

Name
Chemotaxis protein methyltransferase
Synonyms
  • 2.1.1.80
Gene Name
cheR
Organism
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Amino acid sequence
>lcl|BSEQ0011805|Chemotaxis protein methyltransferase
MTSSLPSGQTSVLLQMTQRLALSDAHFRRICQLIYQRAGIVLADHKRDMVYNRLVRRLRA
LGLDDFGRYLSMLEANQNSAEWQAFINALTTNLTAFFREAHHFPILAEHARRRHGEYRVW
SAAASTGEEPYSIAITLADALGMAPGRWKVFASDIDTEVLEKARSGIYRLSELKTLSPQQ
LQRYFMRGTGPHEGLVRVRQELANYVEFSSVNLLEKQYNVPGPFDAIFCRNVMIYFDKTT
QEDILRRFVPLLKPDGLLFAGHSENFSNLVREFSLRGQTVYALSKDKA
Number of residues
288
Molecular Weight
32923.325
Theoretical pI
9.6
GO Classification
Functions
protein-glutamate O-methyltransferase activity
Processes
chemotaxis
General Function
Protein-glutamate o-methyltransferase activity
Specific Function
Methylation of the membrane-bound methyl-accepting chemotaxis proteins (MCP) to form gamma-glutamyl methyl ester residues in MCP.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0011806|Chemotaxis protein methyltransferase (cheR)
ATGACATCATCTCTGCCCTCCGGGCAAACGTCAGTATTGTTACAGATGACACAGCGCCTC
GCGCTGTCCGACGCGCATTTTCGTCGGATATGTCAATTAATCTACCAGCGCGCAGGGATC
GTGCTGGCCGACCATAAGCGGGATATGGTTTATAACCGCCTGGTCCGTCGGCTGCGTGCC
CTGGGACTGGATGATTTTGGCCGTTATCTCAGTATGCTGGAGGCTAATCAAAACAGCGCT
GAGTGGCAGGCTTTTATCAACGCTCTGACTACCAACCTGACCGCTTTTTTTCGCGAGGCG
CACCATTTTCCCATCCTTGCGGAACATGCGCGTCGCCGCCACGGCGAGTACCGCGTCTGG
AGTGCGGCGGCATCGACAGGAGAAGAACCTTACAGTATCGCCATTACGCTGGCGGATGCG
TTAGGGATGGCCCCCGGTCGCTGGAAAGTATTCGCCAGCGATATTGATACTGAAGTGCTG
GAAAAAGCGAGAAGCGGTATTTATCGCCTCAGCGAACTGAAAACGTTATCGCCGCAGCAG
CTACAACGTTACTTCATGCGCGGTACGGGGCCGCATGAAGGACTGGTGCGCGTGCGTCAG
GAACTGGCCAATTATGTTGAATTTTCCTCCGTTAATTTATTGGAAAAGCAGTACAACGTA
CCCGGTCCCTTTGACGCGATTTTTTGCCGTAACGTCATGATCTATTTTGATAAAACGACT
CAGGAGGACATTCTGCGCCGTTTTGTTCCACTCCTTAAACCTGACGGACTGTTGTTTGCC
GGTCACTCAGAAAACTTTAGCAACCTCGTGCGCGAGTTTAGCCTGCGCGGACAGACGGTG
TATGCGCTAAGTAAGGATAAAGCATGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP07801
UniProtKB Entry NameCHER_SALTY
GenBank Gene IDJ02757
General References
  1. Simms SA, Stock AM, Stock JB: Purification and characterization of the S-adenosylmethionine:glutamyl methyltransferase that modifies membrane chemoreceptor proteins in bacteria. J Biol Chem. 1987 Jun 25;262(18):8537-43. [PubMed:3298235]
  2. McClelland M, Sanderson KE, Spieth J, Clifton SW, Latreille P, Courtney L, Porwollik S, Ali J, Dante M, Du F, Hou S, Layman D, Leonard S, Nguyen C, Scott K, Holmes A, Grewal N, Mulvaney E, Ryan E, Sun H, Florea L, Miller W, Stoneking T, Nhan M, Waterston R, Wilson RK: Complete genome sequence of Salmonella enterica serovar Typhimurium LT2. Nature. 2001 Oct 25;413(6858):852-6. [PubMed:11677609]
  3. Djordjevic S, Stock AM: Crystal structure of the chemotaxis receptor methyltransferase CheR suggests a conserved structural motif for binding S-adenosylmethionine. Structure. 1997 Apr 15;5(4):545-58. [PubMed:9115443]
  4. Djordjevic S, Stock AM: Chemotaxis receptor recognition by protein methyltransferase CheR. Nat Struct Biol. 1998 Jun;5(6):446-50. [PubMed:9628482]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails