Tyrosine-protein kinase Lyn

Details

Name
Tyrosine-protein kinase Lyn
Synonyms
  • 2.7.10.2
  • JTK8
  • Lck/Yes-related novel protein tyrosine kinase
  • p53Lyn
  • p56Lyn
  • V-yes-1 Yamaguchi sarcoma viral related oncogene homolog
Gene Name
LYN
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008201|Tyrosine-protein kinase Lyn
MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAK
LNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Number of residues
512
Molecular Weight
58573.595
Theoretical pI
7.13
GO Classification
Functions
ATP binding / enzyme binding / glycosphingolipid binding / ion channel binding / non-membrane spanning protein tyrosine kinase activity / protein tyrosine kinase activity / receptor binding / receptor signaling protein tyrosine kinase activity
Processes
adaptive immune response / axon guidance / B cell homeostasis / B cell receptor signaling pathway / blood coagulation / cellular response to DNA damage stimulus / cellular response to extracellular stimulus / cellular response to heat / cellular response to peptide hormone stimulus / cellular response to retinoic acid / cytokine secretion / dendritic cell differentiation / ephrin receptor signaling pathway / erythrocyte differentiation / Fc receptor mediated inhibitory signaling pathway / Fc receptor mediated stimulatory signaling pathway / Fc-epsilon receptor signaling pathway / Fc-gamma receptor signaling pathway involved in phagocytosis / histamine secretion by mast cell / immune response-regulating cell surface receptor signaling pathway / innate immune response / JAK-STAT cascade involved in growth hormone signaling pathway / leukocyte migration / lipopolysaccharide-mediated signaling pathway / negative regulation of B cell proliferation / negative regulation of cell proliferation / negative regulation of ERK1 and ERK2 cascade / negative regulation of immune response / negative regulation of intracellular signal transduction / negative regulation of MAP kinase activity / negative regulation of mast cell proliferation / negative regulation of myeloid leukocyte differentiation / negative regulation of protein phosphorylation / negative regulation of toll-like receptor 2 signaling pathway / negative regulation of toll-like receptor 4 signaling pathway / neuron projection development / oligodendrocyte development / peptidyl-tyrosine autophosphorylation / peptidyl-tyrosine phosphorylation / platelet activation / platelet degranulation / positive regulation of B cell receptor signaling pathway / positive regulation of cell migration / positive regulation of cell proliferation / positive regulation of cellular component movement / positive regulation of dendritic cell apoptotic process / positive regulation of Fc receptor mediated stimulatory signaling pathway / positive regulation of glial cell proliferation / positive regulation of mast cell proliferation / positive regulation of neuron projection development / positive regulation of oligodendrocyte progenitor proliferation / positive regulation of phosphatidylinositol 3-kinase activity / positive regulation of stress-activated protein kinase signaling cascade / positive regulation of tyrosine phosphorylation of STAT protein / protein autophosphorylation / protein phosphorylation / regulation of B cell apoptotic process / regulation of B cell receptor signaling pathway / regulation of cell adhesion mediated by integrin / regulation of cytokine production / regulation of cytokine secretion / regulation of ERK1 and ERK2 cascade / regulation of erythrocyte differentiation / regulation of inflammatory response / regulation of mast cell activation / regulation of mast cell degranulation / regulation of monocyte chemotaxis / regulation of platelet aggregation / regulation of protein phosphorylation / regulation of release of sequestered calcium ion into cytosol / response to amino acid / response to axon injury / response to carbohydrate / response to drug / response to hormone / response to insulin / response to organic cyclic compound / response to sterol depletion / response to toxic substance / signal transduction / signal transduction by protein phosphorylation / stimulatory C-type lectin receptor signaling pathway / T cell costimulation / tolerance induction to self antigen / transmembrane receptor protein tyrosine kinase signaling pathway / viral process
Components
cell-cell adherens junction / cytoplasm / cytosol / extracellular exosome / extrinsic component of cytoplasmic side of plasma membrane / Golgi apparatus / integrin alpha2-beta1 complex / mast cell granule / membrane raft / mitochondrial crista / mitochondrial intermembrane space / nucleus / perinuclear region of cytoplasm / plasma membrane / postsynaptic density
General Function
Receptor signaling protein tyrosine kinase activity
Specific Function
Non-receptor tyrosine-protein kinase that transmits signals from cell surface receptors and plays an important role in the regulation of innate and adaptive immune responses, hematopoiesis, responses to growth factors and cytokines, integrin signaling, but also responses to DNA damage and genotoxic agents. Functions primarily as negative regulator, but can also function as activator, depending on the context. Required for the initiation of the B-cell response, but also for its down-regulation and termination. Plays an important role in the regulation of B-cell differentiation, proliferation, survival and apoptosis, and is important for immune self-tolerance. Acts downstream of several immune receptors, including the B-cell receptor, CD79A, CD79B, CD5, CD19, CD22, FCER1, FCGR2, FCGR1A, TLR2 and TLR4. Plays a role in the inflammatory response to bacterial lipopolysaccharide. Mediates the responses to cytokines and growth factors in hematopoietic progenitors, platelets, erythrocytes, and in mature myeloid cells, such as dendritic cells, neutrophils and eosinophils. Acts downstream of EPOR, KIT, MPL, the chemokine receptor CXCR4, as well as the receptors for IL3, IL5 and CSF2. Plays an important role in integrin signaling. Regulates cell proliferation, survival, differentiation, migration, adhesion, degranulation, and cytokine release. Down-regulates signaling pathways by phosphorylation of immunoreceptor tyrosine-based inhibitory motifs (ITIM), that then serve as binding sites for phosphatases, such as PTPN6/SHP-1, PTPN11/SHP-2 and INPP5D/SHIP-1, that modulate signaling by dephosphorylation of kinases and their substrates. Phosphorylates LIME1 in response to CD22 activation. Phosphorylates BTK, CBL, CD5, CD19, CD72, CD79A, CD79B, CSF2RB, DOK1, HCLS1, LILRB3/PIR-B, MS4A2/FCER1B, PTK2B/PYK2, SYK and TEC. Promotes phosphorylation of SIRPA, PTPN6/SHP-1, PTPN11/SHP-2 and INPP5D/SHIP-1. Mediates phosphorylation of the BCR-ABL fusion protein. Required for rapid phosphorylation of FER in response to FCER1 activation. Mediates KIT phosphorylation. Acts as an effector of EPOR (erythropoietin receptor) in controlling KIT expression and may play a role in erythroid differentiation during the switch between proliferation and maturation. Depending on the context, activates or inhibits several signaling cascades. Regulates phosphatidylinositol 3-kinase activity and AKT1 activation. Regulates activation of the MAP kinase signaling cascade, including activation of MAP2K1/MEK1, MAPK1/ERK2, MAPK3/ERK1, MAPK8/JNK1 and MAPK9/JNK2. Mediates activation of STAT5A and/or STAT5B. Phosphorylates LPXN on 'Tyr-72'. Kinase activity facilitates TLR4-TLR6 heterodimerization and signal initiation.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0017409|Tyrosine-protein kinase Lyn (LYN)
ATGGGATGTATAAAATCAAAAGGGAAAGACAGCTTGAGTGACGATGGAGTAGATTTGAAG
ACTCAACCAGTTCCAGAATCTCAGCTTTTACCTGGACAGAGGTTTCAAACTAAAGATCCA
GAGGAACAAGGAGACATTGTGGTAGCCTTGTACCCCTATGATGGCATCCACCCGGACGAC
TTGTCTTTCAAGAAAGGAGAGAAGATGAAAGTCCTGGAGGAGCATGGAGAATGGTGGAAA
GCAAAGTCCCTTTTAACAAAAAAAGAAGGCTTCATCCCCAGCAACTATGTGGCCAAACTC
AACACCTTAGAAACAGAAGAGTGGTTTTTCAAGGATATAACCAGGAAGGACGCAGAAAGG
CAGCTTTTGGCACCAGGAAATAGCGCTGGAGCTTTCCTTATTAGAGAAAGTGAAACATTA
AAAGGAAGCTTCTCTCTGTCTGTCAGAGACTTTGACCCTGTGCATGGTGATGTTATTAAG
CACTACAAAATTAGAAGTCTGGATAATGGGGGCTATTACATCTCTCCACGAATCACTTTT
CCCTGTATCAGCGACATGATTAAACATTACCAAAAGCAGGCAGATGGCTTGTGCAGAAGA
TTGGAGAAGGCTTGTATTAGTCCCAAGCCACAGAAGCCATGGGATAAAGATGCCTGGGAG
ATCCCCCGGGAGTCCATCAAGTTGGTGAAAAGGCTTGGCGCTGGGCAGTTTGGGGAAGTC
TGGATGGGTTACTATAACAACAGTACCAAGGTGGCTGTGAAAACCCTGAAGCCAGGAACT
ATGTCTGTGCAAGCCTTCCTGGAAGAAGCCAACCTCATGAAGACCCTGCAGCATGACAAG
CTCGTGAGGCTCTACGCTGTGGTCACCAGGGAGGAGCCCATTTACATCATCACCGAGTAC
ATGGCCAAGGGCAGTTTGCTGGATTTCCTGAAGAGCGATGAAGGTGGCAAAGTGCTGCTT
CCAAAGCTCATTGACTTTTCTGCTCAGATTGCAGAGGGAATGGCATACATCGAGCGGAAG
AACTACATTCACCGGGACCTGCGAGCAGCTAATGTTCTGGTCTCCGAGTCACTCATGTGC
AAAATTGCAGATTTTGGCCTTGCTAGAGTAATTGAAGATAATGAGTACACAGCAAGGGAA
GGTGCTAAGTTCCCTATTAAGTGGACGGCTCCAGAAGCAATCAACTTTGGATGTTTCACT
ATTAAGTCTGATGTGTGGTCCTTTGGAATCCTCCTATACGAAATTGTCACCTATGGGAAA
ATTCCCTACCCAGGGAGAACTAATGCCGACGTGATGACCGCCCTGTCCCAGGGCTACAGG
ATGCCCCGTGTGGAGAACTGCCCAGATGAGCTCTATGACATTATGAAAATGTGCTGGAAA
GAAAAGGCAGAAGAGAGACCAACGTTTGACTACTTACAGAGCGTCCTGGATGATTTCTAC
ACAGCCACGGAAGGGCAATACCAGCAGCAGCCTTAG
Chromosome Location
8
Locus
8q13
External Identifiers
ResourceLink
UniProtKB IDP07948
UniProtKB Entry NameLYN_HUMAN
GenBank Protein ID307144
GenBank Gene IDM16038
HGNC IDHGNC:6735
General References
  1. Yamanashi Y, Fukushige S, Semba K, Sukegawa J, Miyajima N, Matsubara K, Yamamoto T, Toyoshima K: The yes-related cellular gene lyn encodes a possible tyrosine kinase similar to p56lck. Mol Cell Biol. 1987 Jan;7(1):237-43. [Article]
  2. Rider LG, Raben N, Miller L, Jelsema C: The cDNAs encoding two forms of the LYN protein tyrosine kinase are expressed in rat mast cells and human myeloid cells. Gene. 1994 Jan 28;138(1-2):219-22. [Article]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  4. Partanen J, Makela TP, Alitalo R, Lehvaslaiho H, Alitalo K: Putative tyrosine kinases expressed in K-562 human leukemia cells. Proc Natl Acad Sci U S A. 1990 Nov;87(22):8913-7. [Article]
  5. Bielke W, Ziemieki A, Kappos L, Miescher GC: Expression of the B cell-associated tyrosine kinase gene Lyn in primary neuroblastoma tumours and its modulation during the differentiation of neuroblastoma cell lines. Biochem Biophys Res Commun. 1992 Aug 14;186(3):1403-9. [Article]
  6. Roifman CM, Ke S: CD19 is a substrate of the antigen receptor-associated protein tyrosine kinase in human B cells. Biochem Biophys Res Commun. 1993 Jul 15;194(1):222-5. [Article]
  7. Yamanashi Y, Okada M, Semba T, Yamori T, Umemori H, Tsunasawa S, Toyoshima K, Kitamura D, Watanabe T, Yamamoto T: Identification of HS1 protein as a major substrate of protein-tyrosine kinase(s) upon B-cell antigen receptor-mediated signaling. Proc Natl Acad Sci U S A. 1993 Apr 15;90(8):3631-5. [Article]
  8. Wang AV, Scholl PR, Geha RS: Physical and functional association of the high affinity immunoglobulin G receptor (Fc gamma RI) with the kinases Hck and Lyn. J Exp Med. 1994 Sep 1;180(3):1165-70. [Article]
  9. Hata A, Sabe H, Kurosaki T, Takata M, Hanafusa H: Functional analysis of Csk in signal transduction through the B-cell antigen receptor. Mol Cell Biol. 1994 Nov;14(11):7306-13. [Article]
  10. Miller CL, Burkhardt AL, Lee JH, Stealey B, Longnecker R, Bolen JB, Kieff E: Integral membrane protein 2 of Epstein-Barr virus regulates reactivation from latency through dominant negative effects on protein-tyrosine kinases. Immunity. 1995 Feb;2(2):155-66. [Article]
  11. Hirao A, Hamaguchi I, Suda T, Yamaguchi N: Translocation of the Csk homologous kinase (Chk/Hyl) controls activity of CD36-anchored Lyn tyrosine kinase in thrombin-stimulated platelets. EMBO J. 1997 May 1;16(9):2342-51. [Article]
  12. Sarmay G, Koncz G, Pecht I, Gergely J: Fc gamma receptor type IIb induced recruitment of inositol and protein phosphatases to the signal transductory complex of human B-cell. Immunol Lett. 1997 Jun 1;57(1-3):159-64. [Article]
  13. Linnekin D, DeBerry CS, Mou S: Lyn associates with the juxtamembrane region of c-Kit and is activated by stem cell factor in hematopoietic cell lines and normal progenitor cells. J Biol Chem. 1997 Oct 24;272(43):27450-5. [Article]
  14. Yoshida K, Kharbanda S, Kufe D: Functional interaction between SHPTP1 and the Lyn tyrosine kinase in the apoptotic response to DNA damage. J Biol Chem. 1999 Dec 3;274(49):34663-8. [Article]
  15. Keane MM, Ettenberg SA, Nau MM, Banerjee P, Cuello M, Penninger J, Lipkowitz S: cbl-3: a new mammalian cbl family protein. Oncogene. 1999 Jun 3;18(22):3365-75. [Article]
  16. Gaul BS, Harrison ML, Geahlen RL, Burton RA, Post CB: Substrate recognition by the Lyn protein-tyrosine kinase. NMR structure of the immunoreceptor tyrosine-based activation motif signaling region of the B cell antigen receptor. J Biol Chem. 2000 May 26;275(21):16174-82. [Article]
  17. O'Laughlin-Bunner B, Radosevic N, Taylor ML, Shivakrupa, DeBerry C, Metcalfe DD, Zhou M, Lowell C, Linnekin D: Lyn is required for normal stem cell factor-induced proliferation and chemotaxis of primary hematopoietic cells. Blood. 2001 Jul 15;98(2):343-50. [Article]
  18. Rena G, Begg F, Ross A, MacKenzie C, McPhee I, Campbell L, Huston E, Sullivan M, Houslay MD: Molecular cloning, genomic positioning, promoter identification, and characterization of the novel cyclic amp-specific phosphodiesterase PDE4A10. Mol Pharmacol. 2001 May;59(5):996-1011. [Article]
  19. Yoshida K, Weichselbaum R, Kharbanda S, Kufe D: Role for Lyn tyrosine kinase as a regulator of stress-activated protein kinase activity in response to DNA damage. Mol Cell Biol. 2000 Aug;20(15):5370-80. [Article]
  20. Grishin AV, Azhipa O, Semenov I, Corey SJ: Interaction between growth arrest-DNA damage protein 34 and Src kinase Lyn negatively regulates genotoxic apoptosis. Proc Natl Acad Sci U S A. 2001 Aug 28;98(18):10172-7. Epub 2001 Aug 21. [Article]
  21. Liang X, Wisniewski D, Strife A, Shivakrupa, Clarkson B, Resh MD: Phosphatidylinositol 3-kinase and Src family kinases are required for phosphorylation and membrane recruitment of Dok-1 in c-Kit signaling. J Biol Chem. 2002 Apr 19;277(16):13732-8. Epub 2002 Feb 1. [Article]
  22. Li Y, Chen W, Ren J, Yu WH, Li Q, Yoshida K, Kufe D: DF3/MUC1 signaling in multiple myeloma cells is regulated by interleukin-7. Cancer Biol Ther. 2003 Mar-Apr;2(2):187-93. [Article]
  23. Cen O, Gorska MM, Stafford SJ, Sur S, Alam R: Identification of UNC119 as a novel activator of SRC-type tyrosine kinases. J Biol Chem. 2003 Mar 7;278(10):8837-45. Epub 2002 Dec 19. [Article]
  24. Lannutti BJ, Drachman JG: Lyn tyrosine kinase regulates thrombopoietin-induced proliferation of hematopoietic cell lines and primary megakaryocytic progenitors. Blood. 2004 May 15;103(10):3736-43. Epub 2004 Jan 15. [Article]
  25. Kasahara K, Nakayama Y, Ikeda K, Fukushima Y, Matsuda D, Horimoto S, Yamaguchi N: Trafficking of Lyn through the Golgi caveolin involves the charged residues on alphaE and alphaI helices in the kinase domain. J Cell Biol. 2004 Jun 7;165(5):641-52. Epub 2004 Jun 1. [Article]
  26. Roskoski R Jr: Signaling by Kit protein-tyrosine kinase--the stem cell factor receptor. Biochem Biophys Res Commun. 2005 Nov 11;337(1):1-13. [Article]
  27. Brunati AM, Deana R, Folda A, Massimino ML, Marin O, Ledro S, Pinna LA, Donella-Deana A: Thrombin-induced tyrosine phosphorylation of HS1 in human platelets is sequentially catalyzed by Syk and Lyn tyrosine kinases and associated with the cellular migration of the protein. J Biol Chem. 2005 Jun 3;280(22):21029-35. Epub 2005 Mar 28. [Article]
  28. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [Article]
  29. Nakata Y, Tomkowicz B, Gewirtz AM, Ptasznik A: Integrin inhibition through Lyn-dependent cross talk from CXCR4 chemokine receptors in normal human CD34+ marrow cells. Blood. 2006 Jun 1;107(11):4234-9. Epub 2006 Feb 7. [Article]
  30. Meyn MA 3rd, Wilson MB, Abdi FA, Fahey N, Schiavone AP, Wu J, Hochrein JM, Engen JR, Smithgall TE: Src family kinases phosphorylate the Bcr-Abl SH3-SH2 region and modulate Bcr-Abl transforming activity. J Biol Chem. 2006 Oct 13;281(41):30907-16. Epub 2006 Aug 15. [Article]
  31. Ingley E, Schneider JR, Payne CJ, McCarthy DJ, Harder KW, Hibbs ML, Klinken SP: Csk-binding protein mediates sequential enzymatic down-regulation and degradation of Lyn in erythropoietin-stimulated cells. J Biol Chem. 2006 Oct 20;281(42):31920-9. Epub 2006 Aug 18. [Article]
  32. Rathore VB, Okada M, Newman PJ, Newman DK: Paxillin family members function as Csk-binding proteins that regulate Lyn activity in human and murine platelets. Biochem J. 2007 Apr 15;403(2):275-81. [Article]
  33. Chew V, Lam KP: Leupaxin negatively regulates B cell receptor signaling. J Biol Chem. 2007 Sep 14;282(37):27181-91. Epub 2007 Jul 19. [Article]
  34. Zhang J, Suzuki K, Hitomi T, Siraganian RP: TOM1L1 is a Lyn substrate involved in FcepsilonRI signaling in mast cells. J Biol Chem. 2007 Dec 28;282(52):37669-77. Epub 2007 Oct 31. [Article]
  35. Dos Santos C, Demur C, Bardet V, Prade-Houdellier N, Payrastre B, Recher C: A critical role for Lyn in acute myeloid leukemia. Blood. 2008 Feb 15;111(4):2269-79. Epub 2007 Dec 3. [Article]
  36. Tauzin S, Ding H, Khatib K, Ahmad I, Burdevet D, van Echten-Deckert G, Lindquist JA, Schraven B, Din NU, Borisch B, Hoessli DC: Oncogenic association of the Cbp/PAG adaptor protein with the Lyn tyrosine kinase in human B-NHL rafts. Blood. 2008 Feb 15;111(4):2310-20. Epub 2007 Dec 10. [Article]
  37. Wu J, Meng F, Lu H, Kong L, Bornmann W, Peng Z, Talpaz M, Donato NJ: Lyn regulates BCR-ABL and Gab2 tyrosine phosphorylation and c-Cbl protein stability in imatinib-resistant chronic myelogenous leukemia cells. Blood. 2008 Apr 1;111(7):3821-9. doi: 10.1182/blood-2007-08-109330. Epub 2008 Jan 30. [Article]
  38. Ikeda K, Nakayama Y, Togashi Y, Obata Y, Kuga T, Kasahara K, Fukumoto Y, Yamaguchi N: Nuclear localization of Lyn tyrosine kinase mediated by inhibition of its kinase activity. Exp Cell Res. 2008 Nov 1;314(18):3392-404. doi: 10.1016/j.yexcr.2008.08.019. Epub 2008 Sep 11. [Article]
  39. Malik M, Chen YY, Kienzle MF, Tomkowicz BE, Collman RG, Ptasznik A: Monocyte migration and LFA-1-mediated attachment to brain microvascular endothelia is regulated by SDF-1 alpha through Lyn kinase. J Immunol. 2008 Oct 1;181(7):4632-7. [Article]
  40. Wu J, Meng F, Kong LY, Peng Z, Ying Y, Bornmann WG, Darnay BG, Lamothe B, Sun H, Talpaz M, Donato NJ: Association between imatinib-resistant BCR-ABL mutation-negative leukemia and persistent activation of LYN kinase. J Natl Cancer Inst. 2008 Jul 2;100(13):926-39. doi: 10.1093/jnci/djn188. Epub 2008 Jun 24. [Article]
  41. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [Article]
  42. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [Article]
  43. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [Article]
  44. Voss M, Lettau M, Janssen O: Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening. BMC Immunol. 2009 Oct 6;10:53. doi: 10.1186/1471-2172-10-53. [Article]
  45. Kleino I, Ortiz RM, Yritys M, Huovila AP, Saksela K: Alternative splicing of ADAM15 regulates its interactions with cellular SH3 proteins. J Cell Biochem. 2009 Nov 1;108(4):877-85. doi: 10.1002/jcb.22317. [Article]
  46. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [Article]
  47. Collins M, Tremblay M, Chapman N, Curtiss M, Rothman PB, Houtman JC: The T cell receptor-mediated phosphorylation of Pyk2 tyrosines 402 and 580 occurs via a distinct mechanism than other receptor systems. J Leukoc Biol. 2010 Apr;87(4):691-701. doi: 10.1189/jlb.0409227. Epub 2009 Dec 22. [Article]
  48. Stewart CR, Stuart LM, Wilkinson K, van Gils JM, Deng J, Halle A, Rayner KJ, Boyer L, Zhong R, Frazier WA, Lacy-Hulbert A, El Khoury J, Golenbock DT, Moore KJ: CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer. Nat Immunol. 2010 Feb;11(2):155-61. doi: 10.1038/ni.1836. Epub 2009 Dec 27. [Article]
  49. Mund T, Pelham HR: Regulation of PTEN/Akt and MAP kinase signaling pathways by the ubiquitin ligase activators Ndfip1 and Ndfip2. Proc Natl Acad Sci U S A. 2010 Jun 22;107(25):11429-34. doi: 10.1073/pnas.0911714107. Epub 2010 Jun 7. [Article]
  50. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [Article]
  51. Draber P, Vonkova I, Stepanek O, Hrdinka M, Kucova M, Skopcova T, Otahal P, Angelisova P, Horejsi V, Yeung M, Weiss A, Brdicka T: SCIMP, a transmembrane adaptor protein involved in major histocompatibility complex class II signaling. Mol Cell Biol. 2011 Nov;31(22):4550-62. doi: 10.1128/MCB.05817-11. Epub 2011 Sep 19. [Article]
  52. Lowell CA: Src-family kinases: rheostats of immune cell signaling. Mol Immunol. 2004 Jul;41(6-7):631-43. [Article]
  53. Gauld SB, Cambier JC: Src-family kinases in B-cell development and signaling. Oncogene. 2004 Oct 18;23(48):8001-6. [Article]
  54. Xu Y, Harder KW, Huntington ND, Hibbs ML, Tarlinton DM: Lyn tyrosine kinase: accentuating the positive and the negative. Immunity. 2005 Jan;22(1):9-18. [Article]
  55. Hibbs ML, Harder KW: The duplicitous nature of the Lyn tyrosine kinase in growth factor signaling. Growth Factors. 2006 Jun;24(2):137-49. [Article]
  56. Rivera J, Fierro NA, Olivera A, Suzuki R: New insights on mast cell activation via the high affinity receptor for IgE. Adv Immunol. 2008;98:85-120. doi: 10.1016/S0065-2776(08)00403-3. [Article]
  57. Scapini P, Pereira S, Zhang H, Lowell CA: Multiple roles of Lyn kinase in myeloid cell signaling and function. Immunol Rev. 2009 Mar;228(1):23-40. doi: 10.1111/j.1600-065X.2008.00758.x. [Article]
  58. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. [Article]
  59. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
  60. Thinon E, Serwa RA, Broncel M, Brannigan JA, Brassat U, Wright MH, Heal WP, Wilkinson AJ, Mann DJ, Tate EW: Global profiling of co- and post-translationally N-myristoylated proteomes in human cells. Nat Commun. 2014 Sep 26;5:4919. doi: 10.1038/ncomms5919. [Article]
  61. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [Article]
  62. Schweimer K, Hoffmann S, Bauer F, Friedrich U, Kardinal C, Feller SM, Biesinger B, Sticht H: Structural investigation of the binding of a herpesviral protein to the SH3 domain of tyrosine kinase Lck. Biochemistry. 2002 Apr 23;41(16):5120-30. [Article]
  63. Bauer F, Schweimer K, Meiselbach H, Hoffmann S, Rosch P, Sticht H: Structural characterization of Lyn-SH3 domain in complex with a herpesviral protein reveals an extended recognition motif that enhances binding affinity. Protein Sci. 2005 Oct;14(10):2487-98. Epub 2005 Sep 9. [Article]
  64. Miyano N, Kinoshita T, Nakai R, Kirii Y, Yokota K, Tada T: Structural basis for the inhibitor recognition of human Lyn kinase domain. Bioorg Med Chem Lett. 2009 Dec 1;19(23):6557-60. doi: 10.1016/j.bmcl.2009.10.038. Epub 2009 Oct 13. [Article]
  65. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB030231-Tert-Butyl-3-(4-Chloro-Phenyl)-1h-Pyrazolo[3,4-D]Pyrimidin-4-YlamineexperimentalunknownDetails
DB06616BosutinibapprovedyesinhibitorDetails
DB08901Ponatinibapproved, investigationalunknowninhibitorDetails
DB09079NintedanibapprovedunknowninhibitorDetails
DB01254Dasatinibapproved, investigationalunknowninhibitorDetails
DB12010Fostamatinibapproved, investigationalunknowninhibitorDetails