Muscarinic acetylcholine receptor M4

Details

Name
Muscarinic acetylcholine receptor M4
Synonyms
Not Available
Gene Name
CHRM4
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010280|Muscarinic acetylcholine receptor M4
MANFTPVNGSSGNQSVRLVTSSSHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVN
RQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASV
MNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTV
PDNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAK
TLAFLKSPLMKQSVKKPPPGEAAREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGS
ATQNTKERPATELSTTEATTPAMPAPPLQPRALNPASRWSKIQIVTKQTGNECVTAIEIV
PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV
LVNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
Number of residues
479
Molecular Weight
53048.65
Theoretical pI
10.34
GO Classification
Functions
G-protein coupled acetylcholine receptor activity / guanyl-nucleotide exchange factor activity
Processes
adenylate cyclase-inhibiting G-protein coupled acetylcholine receptor signaling pathway / cell proliferation / cell surface receptor signaling pathway / G-protein coupled acetylcholine receptor signaling pathway / phospholipase C-activating G-protein coupled acetylcholine receptor signaling pathway / regulation of locomotion / response to organic substance / sensory perception of chemical stimulus / signal transduction / synaptic transmission, cholinergic
Components
asymmetric synapse / axon terminus / cell junction / cytoplasm / integral component of plasma membrane / neuronal cell body / plasma membrane / postsynaptic density / postsynaptic membrane / sarcolemma / synapse
General Function
Guanyl-nucleotide exchange factor activity
Specific Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is inhibition of adenylate cyclase.
Pfam Domain Function
Transmembrane Regions
32-54 69-89 107-128 149-171 194-216 402-422 437-456
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010281|Muscarinic acetylcholine receptor M4 (CHRM4)
ATGGCCAACTTCACACCTGTCAATGGCAGCTCGGGCAATCAGTCCGTGCGCCTGGTCACG
TCATCATCCCACAATCGCTATGAGACGGTGGAAATGGTCTTCATTGCCACAGTGACAGGC
TCCCTGAGCCTGGTGACTGTCGTGGGCAACATCCTGGTGATGCTGTCCATCAAGGTCAAC
AGGCAGCTGCAGACAGTCAACAACTACTTCCTCTTCAGCCTGGCGTGTGCTGATCTCATC
ATAGGCGCCTTCTCCATGAACCTCTACACCGTGTACATCATCAAGGGCTACTGGCCCCTG
GGCGCCGTGGTCTGCGACCTGTGGCTGGCCCTGGACTACGTGGTGAGCAACGCCTCCGTC
ATGAACCTTCTCATCATCAGCTTTGACCGCTACTTCTGCGTCACCAAGCCTCTCACCTAC
CCTGCCCGGCGCACCACCAAGATGGCAGGCCTCATGATTGCTGCTGCCTGGGTACTGTCC
TTCGTGCTCTGGGCGCCTGCCATCTTGTTCTGGCAGTTTGTGGTGGGTAAGCGGACGGTG
CCCGACAACCAGTGCTTCATCCAGTTCCTGTCCAACCCAGCAGTGACCTTTGGCACAGCC
ATTGCTGCCTTCTACCTGCCTGTGGTCATCATGACGGTGCTGTACATCCACATCTCCCTG
GCCAGTCGCAGCCGAGTCCACAAGCACCGGCCCGAGGGCCCGAAGGAGAAGAAAGCCAAG
ACGCTGGCCTTCCTCAAGAGCCCACTAATGAAGCAGAGCGTCAAGAAGCCCCCGCCCGGG
GAGGCCGCCCGGGAGGAGCTGCGCAATGGCAAGCTGGAGGAGGCCCCCCCGCCAGCGCTG
CCACCGCCACCGCGCCCCGTGGCTGATAAGGACACTTCCAATGAGTCCAGCTCAGGCAGT
GCCACCCAGAACACCAAGGAACGCCCAGCCACAGAGCTGTCCACCACAGAGGCCACCACG
CCCGCCATGCCCGCCCCTCCCCTGCAGCCGCGGGCCCTCAACCCAGCCTCCAGATGGTCC
AAGATCCAGATTGTGACGAAGCAGACAGGCAATGAGTGTGTGACAGCCATTGAGATTGTG
CCTGCCACGCCGGCTGGCATGCGCCCTGCGGCCAACGTGGCCCGCAAGTTCGCCAGCATC
GCTCGCAACCAGGTGCGCAAGAAGCGGCAGATGGCGGCCCGGGAGCGCAAAGTGACACGA
ACGATCTTTGCCATTCTGCTAGCCTTCATCCTCACCTGGACGCCCTACAACGTCATGGTC
CTGGTGAACACCTTCTGCCAGAGCTGCATCCCTGACACGGTGTGGTCCATTGGCTACTGG
CTCTGCTACGTCAACAGCACCATCAACCCTGCCTGCTATGCTCTGTGCAACGCCACCTTT
AAAAAGACCTTCCGGCACCTGCTGCTGTGCCAGTATCGGAACATCGGCACTGCCAGGTAG
Chromosome Location
11
Locus
11p12-p11.2
External Identifiers
ResourceLink
UniProtKB IDP08173
UniProtKB Entry NameACM4_HUMAN
GenBank Protein ID61970253
GenBank Gene IDM16405
GenAtlas IDCHRM4
HGNC IDHGNC:1953
General References
  1. Bonner TI, Buckley NJ, Young AC, Brann MR: Identification of a family of muscarinic acetylcholine receptor genes. Science. 1987 Jul 31;237(4814):527-32. [PubMed:3037705]
  2. Bonner TI, Young AC, Brann MR, Buckley NJ: Cloning and expression of the human and rat m5 muscarinic acetylcholine receptor genes. Neuron. 1988 Jul;1(5):403-10. [PubMed:3272174]
  3. Peralta EG, Ashkenazi A, Winslow JW, Smith DH, Ramachandran J, Capon DJ: Distinct primary structures, ligand-binding properties and tissue-specific expression of four human muscarinic acetylcholine receptors. EMBO J. 1987 Dec 20;6(13):3923-9. [PubMed:3443095]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00767BenzquinamidewithdrawnyesantagonistDetails
DB00809Tropicamideapproved, investigationalyesantagonistDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB00340MetixeneapprovedyesantagonistDetails
DB00387ProcyclidineapprovedyesantagonistDetails
DB00420Promazineapproved, vet_approvedunknownantagonistDetails
DB00572Atropineapproved, vet_approvedyesantagonistDetails
DB00725Homatropine methylbromideapprovedyesantagonistDetails
DB00777PropiomazineapprovedunknownantagonistDetails
DB00785CryptenamineapprovedyesantagonistDetails
DB01069Promethazineapproved, investigationalunknownantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB05752ALKS 27investigationalunknownDetails
DB00622Nicardipineapproved, investigationalunknownantagonistDetails
DB01224QuetiapineapprovedunknownligandDetails
DB00246ZiprasidoneapprovednoantagonistDetails
DB00363ClozapineapprovednoantagonistDetails
DB00496Darifenacinapproved, investigationalunknownantagonistDetails
DB00424HyoscyamineapprovedunknownantagonistDetails
DB01239Chlorprothixeneapproved, experimental, investigational, withdrawnnoantagonistDetails
DB01142Doxepinapproved, investigationalunknownantagonistDetails
DB01151Desipramineapproved, investigationalnoantagonistDetails
DB00458ImipramineapprovednoantagonistDetails
DB00540NortriptylineapprovednoantagonistDetails
DB00835BrompheniramineapprovedunknownantagonistDetails
DB00747Scopolamineapproved, investigationalunknownantagonistDetails
DB00376TrihexyphenidylapprovedunknownantagonistDetails
DB01591SolifenacinapprovedunknownantagonistDetails
DB00934Maprotilineapproved, investigationalnoantagonistDetails
DB01036Tolterodineapproved, investigationalyesantagonistDetails
DB06702FesoterodineapprovedunknownantagonistDetails
DB01625Isopropamideapproved, vet_approvedunknownantagonistDetails
DB08897AclidiniumapprovedyesantagonistDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00342Terfenadineapproved, withdrawnunknownbinderDetails
DB09076UmeclidiniumapprovednoantagonistDetails
DB06787HexocycliumapprovedunknownantagonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB03128Acetylcholineapproved, investigationalunknownDetails
DB01409TiotropiumapprovedunknownDetails
DB01019BethanecholapprovedunknownDetails
DB00411CarbamoylcholineapprovedunknownDetails
DB01085Pilocarpineapproved, investigationalunknownpartial agonistDetails
DB11181HomatropineapprovedyesantagonistDetails
DB12278Propiverineapproved, investigationalunknownantagonistDetails
DB11235ThonzylamineapprovedunknownantagonistDetails
DB13581RociverineexperimentalyesantagonistDetails
DB09089TrimebutineapprovedyesantagonistDetails
DB14185Aripiprazole lauroxilapproved, investigationalnoDetails
DB01238Aripiprazoleapproved, investigationalunknownligandDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00726TrimipramineapprovedunknownbinderDetails
DB00454MeperidineapprovedunknownbinderDetails
DB00568Cinnarizineapproved, investigationalunknownbinderDetails
DB01221Ketamineapproved, vet_approvedunknownbinderDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB11855Revefenacinapproved, investigationalyesantagonistDetails
DB00321AmitriptylineapprovedunknownligandDetails
DB00715Paroxetineapproved, investigationalunknowninhibitorDetails