Cytochrome c1, heme protein, mitochondrial

Details

Name
Cytochrome c1, heme protein, mitochondrial
Synonyms
  • Complex III subunit 4
  • Complex III subunit IV
  • Cytochrome b-c1 complex subunit 4
  • Cytochrome c-1
  • Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit
Gene Name
CYC1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0020718|Cytochrome c1, heme protein, mitochondrial
MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVM
LSALGMLAAGGAGLAMALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQV
CASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYP
NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLV
PLVYTIKRHKWSVLKSRKLAYRPPK
Number of residues
325
Molecular Weight
35421.61
Theoretical pI
9.25
GO Classification
Functions
electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity / heme binding / metal ion binding
Processes
cellular metabolic process / respiratory electron transport chain / response to glucagon / small molecule metabolic process
Components
integral component of membrane / membrane / mitochondrial inner membrane / mitochondrion / nucleus / respiratory chain
General Function
Metal ion binding
Specific Function
This is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.
Pfam Domain Function
Transmembrane Regions
292-306
Cellular Location
Mitochondrion inner membrane
Gene sequence
>lcl|BSEQ0020719|Cytochrome c1, heme protein, mitochondrial (CYC1)
ATGGCGGCAGCTGCGGCTTCGCTTCGCGGGGTAGTGTTGGGCCCGCGGGGCGCGGGGCTC
CCGGGCGCGCGTGCCCGGGGTCTGCTGTGCAGCGCGCGTCCCGGGCAGCTCCCGCTACGG
ACACCTCAGGCAGTGGCCTTGTCGTCGAAGTCTGGCCTTTCCCGAGGCCGGAAAGTGATG
CTGTCAGCGCTGGGCATGCTGGCGGCAGGGGGTGCGGGGCTGGCCGTGGCTCTGCATTCG
GCTGTGAGTGCCAGTGACCTGGAGCTGCACCCCCCCAGCTATCCGTGGTCTCACCGTGGC
CTCCTCTCTTCCTTGGACCACACCAGCATCCGGAGGGGTTTCCAGGTATATAAGCAGGTG
TGCGCCTCCTGCCACAGCATGGACTTCGTGGCCTACCGCCACCTGGTGGGCGTGTGCTAC
ACGGAGGATGAAGCTAAGGAGCTGGCTGCGGAGGTGGAGGTTCAAGACGGCCCCAATGAA
GATGGGGAGATGTTCATGCGGCCAGGGAAGCTGTTCGACTATTTCCCAAAACCATACCCC
AACAGTGAGGCTGCTCGAGCTGCCAACAACGGAGCATTGCCCCCTGACCTCAGCTACATC
GTGCGAGCTAGGCATGGTGGTGAGGACTACGTCTTCTCCCTGCTCACGGGCTACTGCGAG
CCACCCACCGGGGTGTCACTGCGGGAAGGTCTCTACTTCAACCCCTACTTTCCTGGCCAG
GCCATTGCCATGGCCCCTCCCATCTACACAGATGTCTTAGAGTTTGACGATGGCACCCCA
GCTACCATGTCCCAGATAGCCAAGGATGTGTGCACCTTCCTGCGCTGGGCATCTGAGCCA
GAGCACGACCATCGAAAACGCATGGGGCTCAAGATGTTGATGATGATGGCTCTGCTGGTG
CCCCTGGTCTACACCATAAAGCGGCACAAGTGGTCAGTCCTGAAGAGTCGGAAGCTGGCA
TATCGGCCGCCCAAGTGA
Chromosome Location
8
Locus
8q24.3
External Identifiers
ResourceLink
UniProtKB IDP08574
UniProtKB Entry NameCY1_HUMAN
GenBank Protein ID181238
GenBank Gene IDM16597
HGNC IDHGNC:2579
General References
  1. Nishikimi M, Ohta S, Suzuki H, Tanaka T, Kikkawa F, Tanaka M, Kagawa Y, Ozawa T: Nucleotide sequence of a cDNA encoding the precursor to human cytochrome c1. Nucleic Acids Res. 1988 Apr 25;16(8):3577. [PubMed:2836796]
  2. Suzuki H, Hosokawa Y, Nishikimi M, Ozawa T: Structural organization of the human mitochondrial cytochrome c1 gene. J Biol Chem. 1989 Jan 25;264(3):1368-74. [PubMed:2536365]
  3. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [PubMed:16421571]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Nishikimi M, Suzuki H, Ohta S, Sakurai T, Shimomura Y, Tanaka M, Kagawa Y, Ozawa T: Isolation of a cDNA clone for human cytochrome c1 from a lambda gt11 expression library. Biochem Biophys Res Commun. 1987 May 29;145(1):34-9. [PubMed:3036122]
  6. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  7. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  8. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]
  9. Valnot I, Kassis J, Chretien D, de Lonlay P, Parfait B, Munnich A, Kachaner J, Rustin P, Rotig A: A mitochondrial cytochrome b mutation but no mutations of nuclearly encoded subunits in ubiquinol cytochrome c reductase (complex III) deficiency. Hum Genet. 1999 Jun;104(6):460-6. [PubMed:10453733]
  10. Gaignard P, Menezes M, Schiff M, Bayot A, Rak M, Ogier de Baulny H, Su CH, Gilleron M, Lombes A, Abida H, Tzagoloff A, Riley L, Cooper ST, Mina K, Sivadorai P, Davis MR, Allcock RJ, Kresoje N, Laing NG, Thorburn DR, Slama A, Christodoulou J, Rustin P: Mutations in CYC1, encoding cytochrome c1 subunit of respiratory chain complex III, cause insulin-responsive hyperglycemia. Am J Hum Genet. 2013 Aug 8;93(2):384-9. doi: 10.1016/j.ajhg.2013.06.015. Epub 2013 Aug 1. [PubMed:23910460]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB07401AzoxystrobinexperimentalunknownDetails
DB041412-Hexyloxy-6-Hydroxymethyl-Tetrahydro-Pyran-3,4,5-TriolexperimentalunknownDetails
DB076365-Heptyl-6-hydroxy-1,3-benzothiazole-4,7-dioneexperimentalunknownDetails
DB07763(5S)-3-ANILINO-5-(2,4-DIFLUOROPHENYL)-5-METHYL-1,3-OXAZOLIDINE-2,4-DIONEexperimentalunknownDetails
DB07778(S)-famoxadoneexperimentalunknownDetails
DB08330METHYL (2Z)-3-METHOXY-2-{2-[(E)-2-PHENYLVINYL]PHENYL}ACRYLATEexperimentalunknownDetails
DB084532-Nonyl-4-quinolinol 1-oxideexperimentalunknownDetails
DB047996-Hydroxy-5-undecyl-4,7-benzothiazoledioneexperimentalunknownDetails
DB08690Ubiquinone Q2experimentalunknownDetails