Keratin, type I cytoskeletal 16

Details

Name
Keratin, type I cytoskeletal 16
Synonyms
  • CK-16
  • Cytokeratin-16
  • K16
  • Keratin-16
  • KRT16A
Gene Name
KRT16
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049882|Keratin, type I cytoskeletal 16
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGG
ACGLGGGYGGGFSSSSSFGSGFGGGYGGGLGAGFGGGLGAGFGGGFAGGDGLLVGSEKVT
MQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPSEIKDYSPYFKTIEDLRNKIIA
ATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLDELTLARTDLEMQ
IEGLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN
RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENS
LEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRL
LEGEDAHLSSQQASGQSYSSREVFTSSSSSSSRQTRPILKEQSSSSFSQGQSS
Number of residues
473
Molecular Weight
51267.39
Theoretical pI
Not Available
GO Classification
Functions
structural constituent of cytoskeleton
Processes
aging / cell proliferation / cornification / cytoskeleton organization / epidermis development / establishment of skin barrier / hair cycle / inflammatory response / innate immune response / intermediate filament cytoskeleton organization / keratinization / keratinocyte differentiation / keratinocyte migration / morphogenesis of an epithelium / negative regulation of cell migration
Components
cytoskeleton / cytosol / extracellular exosome / intermediate filament / nucleus
General Function
Epidermis-specific type I keratin that plays a key role in skin. Acts as a regulator of innate immunity in response to skin barrier breach: required for some inflammatory checkpoint for the skin barrier maintenance.
Specific Function
Structural constituent of cytoskeleton
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0049883|Keratin, type I cytoskeletal 16 (KRT16)
ATGACCACCTGCAGCCGCCAGTTCACCTCCTCCAGCTCCATGAAGGGCTCCTGCGGCATC
GGAGGCGGCATCGGGGGCGGCTCCAGCCGCATCTCCTCCGTCCTGGCCGGAGGGTCCTGC
CGTGCCCCCAGCACCTACGGGGGCGGCCTGTCTGTCTCCTCTCGCTTCTCCTCTGGGGGA
GCCTGCGGGCTGGGGGGCGGCTATGGCGGTGGCTTCAGCAGCAGCAGCAGCTTTGGTAGT
GGCTTCGGGGGAGGATATGGTGGTGGCCTTGGTGCTGGCTTCGGTGGTGGCTTGGGTGCT
GGCTTTGGTGGTGGTTTTGCTGGTGGTGATGGGCTTCTGGTGGGCAGTGAGAAGGTGACC
ATGCAGAACCTCAATGACCGCCTGGCCTCCTACCTGGACAAGGTGCGTGCTCTGGAGGAG
GCCAACGCCGACCTGGAAGTGAAGATCCGTGACTGGTACCAGAGGCAGCGGCCCAGTGAG
ATCAAAGACTACAGTCCCTACTTCAAGACCATCGAGGACCTGAGGAACAAGATCATTGCG
GCCACCATTGAGAATGCGCAGCCCATTTTGCAGATTGACAATGCCAGGCTGGCAGCCGAT
GACTTCAGGACCAAGTATGAGCATGAACTGGCCCTGCGGCAGACTGTGGAGGCCGACGTC
AATGGCCTGCGCCGGGTGTTGGATGAGCTGACCCTGGCCAGGACTGACCTGGAGATGCAG
ATCGAAGGCCTGAAGGAGGAGCTGGCCTACCTGAGGAAGAACCACGAGGAGGAGATGCTT
GCTCTGAGAGGTCAGACCGGCGGAGATGTGAACGTGGAGATGGATGCTGCACCTGGCGTG
GACCTGAGCCGCATCCTGAATGAGATGCGTGACCAGTACGAGCAGATGGCAGAGAAAAAC
CGCAGAGACGCTGAGACCTGGTTCCTGAGCAAGACCGAGGAGCTGAACAAAGAAGTGGCC
TCCAACAGCGAACTGGTACAGAGCAGCCGCAGTGAGGTGACGGAGCTCCGGAGGGTGCTC
CAGGGCCTGGAGATTGAGCTGCAGTCCCAGCTCAGCATGAAAGCATCCCTGGAGAACAGC
CTGGAGGAGACCAAAGGCCGCTACTGCATGCAGCTGTCCCAGATCCAGGGACTGATTGGC
AGTGTGGAGGAGCAGCTGGCCCAGCTACGCTGTGAGATGGAGCAGCAGAGCCAGGAGTAC
CAGATCTTGCTGGATGTGAAGACGCGGCTGGAGCAGGAGATTGCCACCTACCGCCGCCTG
CTGGAGGGCGAGGATGCCCACCTTTCCTCCCAGCAAGCATCTGGCCAATCCTATTCTTCC
CGCGAGGTCTTCACCTCCTCCTCGTCCTCTTCGAGCCGTCAGACCCGGCCCATCCTCAAG
GAGCAGAGCTCATCCAGCTTCAGCCAGGGCCAGAGCTCCTAG
Chromosome Location
17
Locus
17q21.2
External Identifiers
ResourceLink
UniProtKB IDP08779
UniProtKB Entry NameK1C16_HUMAN
HGNC IDHGNC:6423
General References
  1. RayChaudhury A, Marchuk D, Lindhurst M, Fuchs E: Three tightly linked genes encoding human type I keratins: conservation of sequence in the 5'-untranslated leader and 5'-upstream regions of coexpressed keratin genes. Mol Cell Biol. 1986 Feb;6(2):539-48. [PubMed:2431270]
  2. Rosenberg M, RayChaudhury A, Shows TB, Le Beau MM, Fuchs E: A group of type I keratin genes on human chromosome 17: characterization and expression. Mol Cell Biol. 1988 Feb;8(2):722-36. [PubMed:2451124]
  3. Paladini RD, Takahashi K, Gant TM, Coulombe PA: cDNA cloning and bacterial expression of the human type I keratin 16. Biochem Biophys Res Commun. 1995 Oct 13;215(2):517-23. [PubMed:7487986]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. McLean WH, Rugg EL, Lunny DP, Morley SM, Lane EB, Swensson O, Dopping-Hepenstal PJ, Griffiths WA, Eady RA, Higgins C, et al.: Keratin 16 and keratin 17 mutations cause pachyonychia congenita. Nat Genet. 1995 Mar;9(3):273-8. [PubMed:7539673]
  7. Rasmussen HH, van Damme J, Puype M, Gesser B, Celis JE, Vandekerckhove J: Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes. Electrophoresis. 1992 Dec;13(12):960-9. [PubMed:1286667]
  8. Harris RA, Yang A, Stein RC, Lucy K, Brusten L, Herath A, Parekh R, Waterfield MD, O'Hare MJ, Neville MA, Page MJ, Zvelebil MJ: Cluster analysis of an extensive human breast cancer cell line protein expression map database. Proteomics. 2002 Feb;2(2):212-23. [PubMed:11840567]
  9. Nishizawa M, Izawa I, Inoko A, Hayashi Y, Nagata K, Yokoyama T, Usukura J, Inagaki M: Identification of trichoplein, a novel keratin filament-binding protein. J Cell Sci. 2005 Mar 1;118(Pt 5):1081-90. [PubMed:15731013]
  10. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  11. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  12. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]
  13. Shamsher MK, Navsaria HA, Stevens HP, Ratnavel RC, Purkis PE, Kelsell DP, McLean WH, Cook LJ, Griffiths WA, Gschmeissner S, et al.: Novel mutations in keratin 16 gene underly focal non-epidermolytic palmoplantar keratoderma (NEPPK) in two families. Hum Mol Genet. 1995 Oct;4(10):1875-81. [PubMed:8595410]
  14. Smith FJ, Del Monaco M, Steijlen PM, Munro CS, Morvay M, Coleman CM, Rietveld FJ, Uitto J, McLean WH: Novel proline substitution mutations in keratin 16 in two cases of pachyonychia congenita type 1. Br J Dermatol. 1999 Dec;141(6):1010-6. [PubMed:10606845]
  15. Smith FJ, McKusick VA, Nielsen K, Pfendner E, Uitto J, McLean WH: Cloning of multiple keratin 16 genes facilitates prenatal diagnosis of pachyonychia congenita type 1. Prenat Diagn. 1999 Oct;19(10):941-6. [PubMed:10521820]
  16. Smith FJ, Fisher MP, Healy E, Rees JL, Bonifas JM, Epstein EH Jr, Tan EM, Uitto J, McLean WH: Novel keratin 16 mutations and protein expression studies in pachyonychia congenita type 1 and focal palmoplantar keratoderma. Exp Dermatol. 2000 Jun;9(3):170-7. [PubMed:10839714]
  17. Terrinoni A, Puddu P, Didona B, De Laurenzi V, Candi E, Smith FJ, McLean WH, Melino G: A mutation in the V1 domain of K16 is responsible for unilateral palmoplantar verrucous nevus. J Invest Dermatol. 2000 Jun;114(6):1136-40. [PubMed:10844556]
  18. Connors JB, Rahil AK, Smith FJ, McLean WH, Milstone LM: Delayed-onset pachyonychia congenita associated with a novel mutation in the central 2B domain of keratin 16. Br J Dermatol. 2001 May;144(5):1058-62. [PubMed:11359398]
  19. Terrinoni A, Smith FJ, Didona B, Canzona F, Paradisi M, Huber M, Hohl D, David A, Verloes A, Leigh IM, Munro CS, Melino G, McLean WH: Novel and recurrent mutations in the genes encoding keratins K6a, K16 and K17 in 13 cases of pachyonychia congenita. J Invest Dermatol. 2001 Dec;117(6):1391-6. [PubMed:11886499]
  20. Smith FJ, Liao H, Cassidy AJ, Stewart A, Hamill KJ, Wood P, Joval I, van Steensel MA, Bjorck E, Callif-Daley F, Pals G, Collins P, Leachman SA, Munro CS, McLean WH: The genetic basis of pachyonychia congenita. J Investig Dermatol Symp Proc. 2005 Oct;10(1):21-30. [PubMed:16250206]
  21. Liao H, Sayers JM, Wilson NJ, Irvine AD, Mellerio JE, Baselga E, Bayliss SJ, Uliana V, Fimiani M, Lane EB, McLean WH, Leachman SA, Smith FJ: A spectrum of mutations in keratins K6a, K16 and K17 causing pachyonychia congenita. J Dermatol Sci. 2007 Dec;48(3):199-205. Epub 2007 Aug 24. [PubMed:17719747]
  22. Wilson NJ, Leachman SA, Hansen CD, McMullan AC, Milstone LM, Schwartz ME, McLean WH, Hull PR, Smith FJ: A large mutational study in pachyonychia congenita. J Invest Dermatol. 2011 May;131(5):1018-24. doi: 10.1038/jid.2011.20. Epub 2011 Feb 17. [PubMed:21326300]
  23. Fu T, Leachman SA, Wilson NJ, Smith FJ, Schwartz ME, Tang JY: Genotype-phenotype correlations among pachyonychia congenita patients with K16 mutations. J Invest Dermatol. 2011 May;131(5):1025-8. doi: 10.1038/jid.2010.373. Epub 2010 Dec 16. [PubMed:21160496]
  24. Du ZF, Xu CM, Zhao Y, Liu WT, Chen XL, Chen CY, Fang H, Ke HP, Zhang XN: Two novel de novo mutations of KRT6A and KRT16 genes in two Chinese pachyonychia congenita pedigrees with fissured tongue or diffuse plantar keratoderma. Eur J Dermatol. 2012 Jul-Aug;22(4):476-80. doi: 10.1684/ejd.2012.1773. [PubMed:22668561]
  25. Paris F, Hurtado C, Azon A, Aguado L, Vizmanos JL: A new KRT16 mutation associated with a phenotype of pachyonychia congenita. Exp Dermatol. 2013 Dec;22(12):838-9. doi: 10.1111/exd.12262. [PubMed:24118415]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails