Muscarinic acetylcholine receptor M5

Details

Name
Muscarinic acetylcholine receptor M5
Synonyms
Not Available
Gene Name
CHRM5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010217|Muscarinic acetylcholine receptor M5
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPL
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAE
KRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQL
TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPN
YLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
Number of residues
532
Molecular Weight
60073.205
Theoretical pI
9.64
GO Classification
Functions
G-protein coupled acetylcholine receptor activity / phosphatidylinositol phospholipase C activity
Processes
adenylate cyclase-inhibiting G-protein coupled acetylcholine receptor signaling pathway / cell proliferation / dopamine transport / G-protein coupled acetylcholine receptor signaling pathway / gastric acid secretion / phospholipase C-activating G-protein coupled acetylcholine receptor signaling pathway / regulation of phosphatidylinositol dephosphorylation / sensory perception of chemical stimulus / synaptic transmission, cholinergic / transmission of nerve impulse
Components
cell junction / integral component of plasma membrane / plasma membrane / postsynaptic membrane / synapse
General Function
Phosphatidylinositol phospholipase c activity
Specific Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Pfam Domain Function
Transmembrane Regions
30-53 67-87 105-126 147-169 192-214 444-464 479-498
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010218|Muscarinic acetylcholine receptor M5 (CHRM5)
ATGGAAGGGGATTCTTACCACAATGCAACCACCGTCAATGGCACCCCAGTAAATCACCAG
CCTTTGGAACGCCACAGGTTGTGGGAAGTCATCACCATTGCAGCTGTGACTGCTGTGGTA
AGCCTGATCACCATTGTGGGCAATGTCTTGGTCATGATCTCCTTCAAAGTCAACAGCCAG
CTCAAGACAGTTAACAACTATTACCTGCTCAGCTTAGCCTGTGCAGATCTCATCATTGGA
ATCTTCTCCATGAACCTCTACACCACCTACATCCTCATGGGACGCTGGGCTCTCGGGAGT
CTGGCTTGTGACCTTTGGCTTGCACTGGACTACGTGGCCAGCAACGCTTCTGTCATGAAC
CTTCTGGTGATCAGTTTTGACCGTTACTTTTCCATCACAAGACCCTTGACATATCGGGCC
AAGCGTACTCCGAAAAGGGCTGGCATCATGATTGGCTTGGCCTGGCTGATCTCCTTCATC
CTCTGGGCCCCAGCAATCCTCTGCTGGCAGTACTTGGTTGGGAAGCGGACAGTTCCACTG
GATGAGTGCCAGATCCAGTTTCTCTCTGAGCCCACCATCACTTTTGGCACTGCCATTGCT
GCCTTCTACATCCCTGTTTCTGTCATGACCATCCTCTACTGTCGAATCTACCGGGAAACA
GAGAAGCGAACCAAGGACCTGGCTGACCTCCAGGGTTCTGACTCTGTGACCAAAGCTGAG
AAGAGAAAGCCAGCTCATAGGGCTCTGTTCAGATCCTGCTTGCGCTGTCCTCGACCCACC
CTGGCCCAGCGGGAAAGGAACCAGGCCTCCTGGTCATCCTCCCGCAGGAGCACCTCCACC
ACTGGGAAGCCATCCCAAGCCACTGGCCCAAGCGCCAATTGGGCCAAAGCTGAGCAGCTC
ACCACCTGTAGCAGCTACCCTTCCTCAGAGGATGAGGACAAGCCCGCCACTGACCCTGTC
CTCCAAGTGGTCTACAAGAGTCAGGGTAAGGAAAGCCCAGGGGAAGAATTCAGTGCTGAA
GAGACTGAGGAAACTTTTGTGAAAGCTGAAACTGAAAAAAGTGACTATGACACCCCAAAC
TACCTTCTGTCTCCAGCAGCTGCTCATAGACCCAAGAGTCAGAAATGTGTGGCCTATAAG
TTCCGATTGGTGGTAAAAGCTGACGGGAACCAGGAGACCAACAATGGCTGTCACAAGGTG
AAAATCATGCCCTGCCCCTTCCCAGTGGCCAAGGAACCTTCAACGAAAGGCCTCAATCCC
AACCCCAGCCATCAAATGACCAAACGAAAGAGAGTGGTCCTAGTCAAAGAGAGGAAAGCA
GCCCAGACACTGAGTGCCATTCTCCTGGCCTTCATCATCACATGGACCCCGTATAACATC
ATGGTCCTGGTTTCTACCTTCTGTGACAAGTGTGTCCCAGTCACCCTGTGGCACTTGGGC
TATTGGTTGTGCTATGTCAATAGCACTGTCAACCCCATCTGCTATGCCCTCTGCAACAGA
ACCTTCAGGAAGACCTTTAAGATGCTGCTTCTCTGCCGATGGAAAAAGAAAAAAGTGGAA
GAGAAGTTGTACTGGCAGGGGAACAGCAAGCTACCCTGA
Chromosome Location
15
Locus
15q26
External Identifiers
ResourceLink
UniProtKB IDP08912
UniProtKB Entry NameACM5_HUMAN
GenBank Protein ID177988
GenBank Gene IDM80333
GenAtlas IDCHRM5
HGNC IDHGNC:1954
General References
  1. Bonner TI, Young AC, Brann MR, Buckley NJ: Cloning and expression of the human and rat m5 muscarinic acetylcholine receptor genes. Neuron. 1988 Jul;1(5):403-10. [PubMed:3272174]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00340MetixeneapprovedyesantagonistDetails
DB00420Promazineapproved, vet_approvedunknownantagonistDetails
DB00572Atropineapproved, vet_approvedyesantagonistDetails
DB00725Homatropine methylbromideapprovedyesantagonistDetails
DB00767BenzquinamidewithdrawnyesantagonistDetails
DB00777PropiomazineapprovedunknownantagonistDetails
DB00785CryptenamineapprovedyesantagonistDetails
DB01069Promethazineapproved, investigationalunknownantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB05752ALKS 27investigationalunknownDetails
DB00622Nicardipineapproved, investigationalunknownantagonistDetails
DB01224QuetiapineapprovedunknownligandDetails
DB00246ZiprasidoneapprovednoantagonistDetails
DB00363ClozapineapprovednoantagonistDetails
DB00496Darifenacinapproved, investigationalunknownantagonistDetails
DB01239Chlorprothixeneapproved, experimental, investigational, withdrawnnoantagonistDetails
DB01142Doxepinapproved, investigationalunknownantagonistDetails
DB01151Desipramineapproved, investigationalnoantagonistDetails
DB00458ImipramineapprovednoantagonistDetails
DB00540NortriptylineapprovednoantagonistDetails
DB00835BrompheniramineapprovedunknownantagonistDetails
DB00747Scopolamineapproved, investigationalunknownantagonistDetails
DB00376TrihexyphenidylapprovedunknownantagonistDetails
DB01591SolifenacinapprovedunknownantagonistDetails
DB00934Maprotilineapproved, investigationalnoantagonistDetails
DB01036Tolterodineapproved, investigationalyesantagonistDetails
DB06702FesoterodineapprovedunknownantagonistDetails
DB08897AclidiniumapprovedyesantagonistDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00342Terfenadineapproved, withdrawnunknownbinderDetails
DB09076UmeclidiniumapprovednoantagonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB00483Gallamine triethiodideapprovedunknownDetails
DB01409TiotropiumapprovedunknownDetails
DB11181HomatropineapprovedyesantagonistDetails
DB12278Propiverineapproved, investigationalyesDetails
DB11235ThonzylamineapprovedunknownantagonistDetails
DB13581RociverineexperimentalyesantagonistDetails
DB14185Aripiprazole lauroxilapproved, investigationalnoDetails
DB01238Aripiprazoleapproved, investigationalunknownligandDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00726TrimipramineapprovedunknownbinderDetails
DB00454MeperidineapprovedunknownbinderDetails
DB00568Cinnarizineapproved, investigationalunknownbinderDetails
DB01221Ketamineapproved, vet_approvedunknownbinderDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB11855Revefenacinapproved, investigationalyesantagonistDetails
DB00321AmitriptylineapprovedunknownligandDetails
DB00715Paroxetineapproved, investigationalunknowninhibitorDetails