Thymidine kinase
Details
- Name
- Thymidine kinase
- Synonyms
- 2.7.1.21
- Gene Name
- TK
- Organism
- HHV-3
- Amino acid sequence
>lcl|BSEQ0017455|Thymidine kinase MSTDKTDVKMGVLRIYLDGAYGIGKTTAAEEFLHHFAITPNRILLIGEPLSYWRNLAGED AICGIYGTQTRRLNGDVSPEDAQRLTAHFQSLFCSPHAIMHAKISALMDTSTSDLVQVNK EPYKIMLSDRHPIASTICFPLSRYLVGDMSPAALPGLLFTLPAEPPGTNLVVCTVSLPSH LSRVSKRARPGETVNLPFVMVLRNVYIMLINTIIFLKTNNWHAGWNTLSFCNDVFKQKLQ KSECIKLREVPGIEDTLFAVLKLPELCGEFGNILPLWAWGMETLSNCSRSMSPFVLSLEQ TPQHAAQELKTLLPQMTPANMSSGAWNILKELVNAVQDNTS
- Number of residues
- 341
- Molecular Weight
- 37816.49
- Theoretical pI
- Not Available
- GO Classification
- FunctionsATP binding / thymidine kinase activityProcessesDNA biosynthetic process / TMP biosynthetic process
- General Function
- Catalyzes the transfer of the gamma-phospho group of ATP to thymidine to generate dTMP in the salvage pathway of pyrimidine synthesis. The dTMP serves as a substrate for DNA polymerase during viral DNA replication. Allows the virus to be reactivated and to grow in non-proliferative cells lacking a high concentration of phosphorylated nucleic acid precursors.
- Specific Function
- Atp binding
- Pfam Domain Function
- Herpes_TK (PF00693)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P09250 UniProtKB Entry Name KITH_VZVD - General References
- Davison AJ, Scott JE: The complete DNA sequence of varicella-zoster virus. J Gen Virol. 1986 Sep;67 ( Pt 9):1759-816. [Article]
- Sawyer MH, Inchauspe G, Biron KK, Waters DJ, Straus SE, Ostrove JM: Molecular analysis of the pyrimidine deoxyribonucleoside kinase gene of wild-type and acyclovir-resistant strains of varicella-zoster virus. J Gen Virol. 1988 Oct;69 ( Pt 10):2585-93. [Article]