Tyrosine-protein kinase Fgr

Details

Name
Tyrosine-protein kinase Fgr
Synonyms
  • 2.7.10.2
  • Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
  • p55-Fgr
  • p58-Fgr
  • p58c-Fgr
  • Proto-oncogene c-Fgr
  • SRC2
Gene Name
FGR
Organism
Humans
Amino acid sequence
>lcl|BSEQ0021448|Tyrosine-protein kinase Fgr
MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQA
INPGFLDSGTIRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSL
SSGKTGCIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAY
SLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHYMEVNDGLCNLLIAP
CTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSP
KAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPEGQDLRLPQLV
DMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKF
PIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCP
PGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT
Number of residues
529
Molecular Weight
59478.11
Theoretical pI
Not Available
GO Classification
Functions
ATP binding / Fc-gamma receptor I complex binding / immunoglobulin receptor binding / non-membrane spanning protein tyrosine kinase activity / phosphotyrosine binding / protein kinase binding / protein tyrosine kinase activity
Processes
blood coagulation / cell differentiation / cellular response to peptide hormone stimulus / defense response to Gram-positive bacterium / Fc-gamma receptor signaling pathway involved in phagocytosis / immune response-regulating cell surface receptor signaling pathway / innate immune response / integrin-mediated signaling pathway / peptidyl-tyrosine autophosphorylation / peptidyl-tyrosine phosphorylation / positive regulation of cell migration / positive regulation of cytokine secretion / positive regulation of mast cell degranulation / positive regulation of phosphatidylinositol 3-kinase activity / positive regulation of phosphatidylinositol 3-kinase signaling / protein autophosphorylation / protein phosphorylation / regulation of cell proliferation / regulation of cell shape / regulation of innate immune response / regulation of phagocytosis / regulation of protein kinase activity / response to virus / transmembrane receptor protein tyrosine kinase signaling pathway
Components
actin cytoskeleton / cytosol / extracellular exosome / extrinsic component of cytoplasmic side of plasma membrane / mitochondrial inner membrane / mitochondrial intermembrane space / plasma membrane / ruffle membrane
General Function
Protein tyrosine kinase activity
Specific Function
Non-receptor tyrosine-protein kinase that transmits signals from cell surface receptors devoid of kinase activity and contributes to the regulation of immune responses, including neutrophil, monocyte, macrophage and mast cell functions, cytoskeleton remodeling in response to extracellular stimuli, phagocytosis, cell adhesion and migration. Promotes mast cell degranulation, release of inflammatory cytokines and IgE-mediated anaphylaxis. Acts downstream of receptors that bind the Fc region of immunoglobulins, such as MS4A2/FCER1B, FCGR2A and/or FCGR2B. Acts downstream of ITGB1 and ITGB2, and regulates actin cytoskeleton reorganization, cell spreading and adhesion. Depending on the context, activates or inhibits cellular responses. Functions as negative regulator of ITGB2 signaling, phagocytosis and SYK activity in monocytes. Required for normal ITGB1 and ITGB2 signaling, normal cell spreading and adhesion in neutrophils and macrophages. Functions as positive regulator of cell migration and regulates cytoskeleton reorganization via RAC1 activation. Phosphorylates SYK (in vitro) and promotes SYK-dependent activation of AKT1 and MAP kinase signaling. Phosphorylates PLD2 in antigen-stimulated mast cells, leading to PLD2 activation and the production of the signaling molecules lysophosphatidic acid and diacylglycerol. Promotes activation of PIK3R1. Phosphorylates FASLG, and thereby regulates its ubiquitination and subsequent internalization. Phosphorylates ABL1. Promotes phosphorylation of CBL, CTTN, PIK3R1, PTK2/FAK1, PTK2B/PYK2 and VAV2. Phosphorylates HCLS1 that has already been phosphorylated by SYK, but not unphosphorylated HCLS1.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0021449|Tyrosine-protein kinase Fgr (FGR)
ATGGGCTGTGTGTTCTGCAAGAAATTGGAGCCGGTGGCCACGGCCAAGGAGGATGCTGGC
CTGGAAGGGGACTTCAGAAGCTACGGGGCAGCAGACCACTATGGGCCTGACCCCACTAAG
GCCCGGCCTGCATCCTCATTTGCCCACATCCCCAACTACAGCAACTTCTCCTCTCAGGCC
ATCAACCCTGGCTTCCTTGATAGTGGCACCATCAGGGGTGTGTCAGGGATTGGGGTGACC
CTGTTCATTGCCCTGTATGACTATGAGGCTCGAACTGAGGATGACCTCACCTTCACCAAG
GGCGAGAAGTTCCACATCCTGAACAATACTGAAGGTGACTGGTGGGAGGCTCGGTCTCTC
AGCTCCGGAAAAACTGGCTGCATTCCCAGCAACTACGTGGCCCCTGTTGACTCAATCCAA
GCTGAAGAGTGGTACTTTGGAAAGATTGGGAGAAAGGATGCAGAGAGGCAGCTGCTTTCA
CCAGGCAACCCCCAGGGGGCCTTTCTCATTCGGGAAAGCGAGACCACCAAAGGTGCCTAC
TCCCTGTCCATCCGGGACTGGGATCAGACCAGAGGCGATCATGTGAAGCATTACAAGATC
CGCAAACTGGACATGGGCGGCTACTACATCACCACACGGGTTCAGTTCAACTCGGTGCAG
GAGCTGGTGCAGCACTACATGGAGGTGAATGACGGGCTGTGCAACCTGCTCATCGCGCCC
TGCACCATCATGAAGCCGCAGACGCTGGGCCTGGCCAAGGACGCCTGGGAGATCAGCCGC
AGCTCCATCACGCTGGAGCGCCGGCTGGGCACCGGCTGCTTCGGGGATGTGTGGCTGGGC
ACGTGGAACGGCAGCACTAAGGTGGCGGTGAAGACGCTGAAGCCGGGCACCATGTCCCCG
AAGGCCTTCCTGGAGGAGGCGCAGGTCATGAAGCTGCTGCGGCACGACAAGCTGGTGCAG
CTGTACGCCGTGGTGTCGGAGGAGCCCATCTACATCGTGACCGAGTTCATGTGTCACGGC
AGCTTGCTGGATTTTCTCAAGAACCCAGAGGGCCAGGATTTGAGGCTGCCCCAATTGGTG
GACATGGCAGCCCAGGTAGCTGAGGGCATGGCCTACATGGAACGCATGAACTACATTCAC
CGCGACCTGAGGGCAGCCAACATCCTGGTTGGGGAGCGGCTGGCGTGCAAGATCGCAGAC
TTTGGCTTGGCGCGTCTCATCAAGGACGATGAGTACAACCCCTGCCAAGGTTCCAAGTTC
CCCATCAAGTGGACAGCCCCAGAAGCTGCCCTCTTTGGCAGATTCACCATCAAGTCAGAC
GTGTGGTCCTTTGGGATCCTGCTCACTGAGCTCATCACCAAGGGCCGAATCCCCTACCCA
GGCATGAATAAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCT
CCAGGCTGCCCAGCATCCCTGTACGAGGCCATGGAACAGACCTGGCGTCTGGACCCGGAG
GAGAGGCCTACCTTCGAGTACCTGCAGTCCTTCCTGGAGGACTACTTCACCTCCGCTGAA
CCACAGTACCAGCCCGGGGATCAGACATAG
Chromosome Location
1
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP09769
UniProtKB Entry NameFGR_HUMAN
HGNC IDHGNC:3697
General References
  1. Katamine S, Notario V, Rao CD, Miki T, Cheah MS, Tronick SR, Robbins KC: Primary structure of the human fgr proto-oncogene product p55c-fgr. Mol Cell Biol. 1988 Jan;8(1):259-66. [PubMed:3275868]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Brickell PM, Patel M: Structure and expression of c-fgr protooncogene mRNA in Epstein-Barr virus converted cell lines. Br J Cancer. 1988 Dec;58(6):704-9. [PubMed:2852026]
  5. Inoue K, Ikawa S, Semba K, Sukegawa J, Yamamoto T, Toyoshima K: Isolation and sequencing of cDNA clones homologous to the v-fgr oncogene from a human B lymphocyte cell line, IM-9. Oncogene. 1987;1(3):301-4. [PubMed:3330776]
  6. Patel M, Leevers SJ, Brickell PM: Structure of the complete human c-fgr proto-oncogene and identification of multiple transcriptional start sites. Oncogene. 1990 Feb;5(2):201-6. [PubMed:1690869]
  7. Nishizawa M, Semba K, Yoshida MC, Yamamoto T, Sasaki M, Toyoshima K: Structure, expression, and chromosomal location of the human c-fgr gene. Mol Cell Biol. 1986 Feb;6(2):511-7. [PubMed:3023853]
  8. Inoue K, Yamamoto T, Toyoshima K: Specific expression of human c-fgr in natural immunity effector cells. Mol Cell Biol. 1990 Apr;10(4):1789-92. [PubMed:2181286]
  9. Sartor O, Moriuchi R, Sameshima JH, Severino M, Gutkind JS, Robbins KC: Diverse biologic properties imparted by the c-fgr proto-oncogene. J Biol Chem. 1992 Feb 15;267(5):3460-5. [PubMed:1737799]
  10. Hamada F, Aoki M, Akiyama T, Toyoshima K: Association of immunoglobulin G Fc receptor II with Src-like protein-tyrosine kinase Fgr in neutrophils. Proc Natl Acad Sci U S A. 1993 Jul 1;90(13):6305-9. [PubMed:8327512]
  11. Berton G, Fumagalli L, Laudanna C, Sorio C: Beta 2 integrin-dependent protein tyrosine phosphorylation and activation of the FGR protein tyrosine kinase in human neutrophils. J Cell Biol. 1994 Aug;126(4):1111-21. [PubMed:7519620]
  12. Yan SR, Fumagalli L, Berton G: Activation of SRC family kinases in human neutrophils. Evidence that p58C-FGR and p53/56LYN redistributed to a Triton X-100-insoluble cytoskeletal fraction, also enriched in the caveolar protein caveolin, display an enhanced kinase activity. FEBS Lett. 1996 Feb 12;380(1-2):198-203. [PubMed:8603737]
  13. Axelsson L, Hellberg C, Melander F, Smith D, Zheng L, Andersson T: Clustering of beta(2)-integrins on human neutrophils activates dual signaling pathways to PtdIns 3-kinase. Exp Cell Res. 2000 Apr 10;256(1):257-63. [PubMed:10739672]
  14. Sergeant S, Waite KA, Heravi J, McPhail LC: Phosphatidic acid regulates tyrosine phosphorylating activity in human neutrophils: enhancement of Fgr activity. J Biol Chem. 2001 Feb 16;276(7):4737-46. Epub 2000 Nov 14. [PubMed:11078731]
  15. Melander F, Andersson T, Dib K: Fgr but not Syk tyrosine kinase is a target for beta 2 integrin-induced c-Cbl-mediated ubiquitination in adherent human neutrophils. Biochem J. 2003 Mar 1;370(Pt 2):687-94. [PubMed:12435267]
  16. Zuccato E, Blott EJ, Holt O, Sigismund S, Shaw M, Bossi G, Griffiths GM: Sorting of Fas ligand to secretory lysosomes is regulated by mono-ubiquitylation and phosphorylation. J Cell Sci. 2007 Jan 1;120(Pt 1):191-9. Epub 2006 Dec 12. [PubMed:17164290]
  17. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195]
  18. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01254Dasatinibapproved, investigationalunknownDetails
DB12010Fostamatinibapproved, investigationalunknowninhibitorDetails