Nitric oxide synthase oxygenase

Details

Name
Nitric oxide synthase oxygenase
Synonyms
  • 1.14.13.165
  • NOSoxy-like protein
  • SANOS
Gene Name
nos
Organism
Staphylococcus aureus (strain MW2)
Amino acid sequence
>lcl|BSEQ0016449|Nitric oxide synthase oxygenase
MLFKEAQAFIENMYKECHYETQIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSN
RCIGRLFWDSLNVIDARDVTDEASFLSSITYHITQATNEGKLKPYITIYAPKDGPKIFNN
QLIRYAGYDNCGDPAEKEVTRLANHLGWKGKGTNFDVLPLIYQLPNESVKFYEYPTSLIK
EVPIEHNHYPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDY
RYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFE
RNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGYDNTVKDPNFFYKKKESNANQCPFHH
Number of residues
358
Molecular Weight
41709.935
Theoretical pI
7.0
GO Classification
Functions
heme binding / metal ion binding / nitric-oxide synthase activity
Processes
nitric oxide biosynthetic process
General Function
Nitric-oxide synthase activity
Specific Function
Catalyzes the production of nitric oxide.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0002943|1077 bp
ATGTTATTTAAAGAGGCTCAAGCTTTCATAGAAAACATGTATAAAGAGTGTCATTATGAA
ACGCAAATTATCAATAAACGTTTACATGACATTGAACTAGAAATAAAAGAAACTGGGACA
TATACACATACAGAAGAAGAACTTATTTATGGTGCTAAAATGGCTTGGCGTAATTCAAAT
CGTTGCATTGGTCGTTTATTTTGGGATTCGTTAAATGTCATTGATGCAAGAGATGTTACT
GACGAAGCATCGTTCTTATCATCAATTACTTATCATATTACACAGGCTACAAATGAAGGT
AAATTAAAGCCGTATATTACTATATATGCTCCAAAGGATGGACCTAAAATTTTCAACAAT
CAATTAATTCGCTATGCTGGCTATGACAATTGTGGTGATCCTGCTGAAAAAGAAGTTACA
CGCTTAGCAAATCACTTAGGTTGGAAAGGAAAAGGTACTAATTTTGACGTGTTACCACTG
ATTTACCAATTACCTAATGAGTCAGTTAAATTTTACGAATATCCTACTTCATTAATTAAA
GAAGTACCTATTGAACATAATCATTATCCAAAATTAAGAAAATTGAACTTAAAATGGTAT
GCAGTCCCTATCATTTCCAATATGGACTTAAAAATCGGTGGCATTGTATATCCAACTGCA
CCCTTTAACGGTTGGTATATGGTAACTGAAATTGGCGTACGTAACTTTATTGATGATTAC
CGTTACAATTTACTAGAAAAAGTTGCAGATGCGTTTGAATTTGATACACTTAAAAATAAT
TCATTTAATAAAGATCGAGCACTTGTTGAATTGAACTATGCTGTGTATCATTCCTTTAAA
AAAGAAGGCGTATCAATTGTCGATCATTTGACCGCTGCAAAGCAATTCGAACTATTCGAA
CGTAATGAAGCACAACAAGGTCGTCAAGTTACCGGAAAATGGTCTTGGCTAGCGCCGCCA
TTATCTCCAACATTGACGTCAAATTATCATCATGGATATGACAATACAGTAAAAGATCCA
AACTTTTTCTATAAAAAGAAAGAATCAAATGCTAACCAGTGCCCTTTCCATCATTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A094
UniProtKB Entry NameNOSO_STAAW
GenBank Protein ID21205025
GenBank Gene IDBA000033
General References
  1. Baba T, Takeuchi F, Kuroda M, Yuzawa H, Aoki K, Oguchi A, Nagai Y, Iwama N, Asano K, Naimi T, Kuroda H, Cui L, Yamamoto K, Hiramatsu K: Genome and virulence determinants of high virulence community-acquired MRSA. Lancet. 2002 May 25;359(9320):1819-27. [PubMed:12044378]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02234S-EthylisothioureaexperimentalunknownDetails
DB02772Sucroseapproved, experimental, investigationalunknownDetails