Penicillin-binding protein 2B

Details

Name
Penicillin-binding protein 2B
Synonyms
  • pbp2b
Gene Name
penA
Organism
Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Amino acid sequence
>lcl|BSEQ0016021|Penicillin-binding protein 2B
MRKFNSHSIPIRLNLLFSIVILLFMTIIGRLLYMQVLNKDFYEKKLASASQTKITSSSAR
GEIYDASGKPLVENTLKQVVSFTRSNKMTATDLKETAKKLLTYVSISSPNLTERQLADYY
LADPEIYKKIVEALPSEKRLDSDGNRLSESELYNNAVDSVQTSQLNYTEDEKKEIYLFSQ
LNAVGNFATGTIATDPLNDSQVAVIASISKEMPGISISTSWDRKVLETSLSSIVGSVSSE
KAGLPAEEAEAYLKKGYSLNDRVGTSYLEKQYEETLQGKRSVKEIHLDKYGNMESVDTIE
EGSKGNNIKLTIDLAFQDSVDALLKSYFNSELENGGAKYSEGVYAVALNPKTGAVLSMSG
IKHDLKTGELTPDSLGTVTNVFVPGSVVKAATISSGWENGVLSGNQTLTDQSIVFQGSAP
INSWYTQAYGSFPITAVQALEYSSNTYMVQTALGLMGQTYQPNMFVGTSNLESAMEKLRS
TFGEYGLGTATGIDLPDESTGFVPKEYSFANYITNAFGQFDNYTPMQLAQYVATIANNGV
RVAPRIVEGIYGNNDKGGLGDLIQQLQPTEMNKVNISDSDMSILHQGFYQVAHGTSGLTT
GRAFSNGALVSISGKTGTAESYVADGQQATNTNAVAYAPSDNPQIAVAVVFPHNTNLTNG
VGPSIARDIINLYQKYHPMN
Number of residues
680
Molecular Weight
73872.305
Theoretical pI
4.85
GO Classification
Functions
penicillin binding
Processes
cell wall organization / peptidoglycan biosynthetic process / regulation of cell shape / response to antibiotic
Components
integral component of membrane / plasma membrane
General Function
Penicillin binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
9-29
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016022|Penicillin-binding protein 2B (penA)
ATGAGAAAATTTAACAGCCATTCGATTCCGATTCGGCTTAATTTATTGTTTTCAATCGTC
ATTTTACTCTTTATGACCATTATTGGTCGTTTGTTGTATATGCAGGTTTTGAACAAGGAT
TTTTACGAAAAAAAGCTAGCTTCAGCTAGTCAGACCAAGATTACAAGCAGTTCAGCCCGT
GGGGAAATTTATGATGCTAGTGGAAAACCTTTGGTAGAAAATACGTTAAAGCAGGTTGTT
TCCTTTACGCGTAGCAATAAAATGACGGCTACAGACTTAAAAGAAACAGCTAAAAAGTTA
CTGACTTATGTGAGCATCAGTTCTCCAAATTTGACAGAACGCCAGCTGGCGGATTACTAT
TTGGCTGATCCTGAAATCTATAAAAAAATAGTGGAAGCTCTCCCAAGTGAGAAACGCTTG
GATTCAGATGGCAATCGTCTATCCGAATCAGAACTGTATAACAATGCGGTCGATAGTGTA
CAAACGAGTCAACTAAACTATACAGAGGATGAAAAGAAAGAAATCTATCTTTTTAGTCAG
TTAAATGCTGTTGGAAACTTTGCGACAGGAACCATTGCGACAGATCCTCTAAATGATTCT
CAGGTGGCTGTTATTGCCTCTATTTCAAAGGAGATGCCTGGCATTAGTATTTCTACTTCT
TGGGATAGAAAGGTTTTGGAAACTTCCCTTTCTTCTATAGTTGGGAGTGTATCCAGTGAA
AAAGCTGGTCTCCCAGCGGAAGAAGCAGAAGCCTATCTTAAAAAAGGCTATTCTCTAAAT
GACCGTGTAGGAACCTCCTATTTGGAAAAGCAATATGAAGAGACCTTACAAGGAAAACGC
TCGGTAAAAGAAATCCATCTGGATAAATATGGCAATATGGAAAGCGTGGATACAATTGAG
GAAGGTAGTAAGGGAAACAATATCAAACTGACCATTGATTTGGCTTTCCAAGATAGCGTG
GATGCTTTACTGAAAAGTTATTTCAATTCTGAGCTAGAAAATGGTGGAGCCAAGTATTCT
GAAGGTGTCTATGCAGTCGCCCTTAACCCAAAAACAGGTGCGGTTTTGTCTATGTCAGGG
ATTAAACATGACTTGAAAACGGGAGAGTTGACGCCTGATTCCTTGGGAACGGTAACCAAT
GTCTTTGTTCCAGGTTCGGTTGTCAAGGCGGCGACCATCAGCTCAGGTTGGGAAAATGGA
GTCTTGTCAGGAAACCAGACCTTGACAGACCAGTCCATTGTCTTCCAAGGTTCAGCTCCC
ATCAATTCTTGGTATACTCAGGCTTACGGTTCATTCCCTATCACAGCGGTCCAAGCTCTG
GAGTATTCATCAAATACCTATATGGTCCAAACAGCCTTAGGTCTTATGGGGCAAACCTAT
CAACCCAATATGTTTGTCGGCACCAGCAATCTAGAGTCTGCTATGGAGAAACTGCGTTCA
ACCTTTGGCGAATATGGCTTGGGTACTGCGACAGGAATTGACCTACCAGATGAATCTACT
GGATTTGTTCCCAAAGAGTATAGCTTTGCTAATTACATTACTAATGCCTTTGGGCAGTTT
GATAACTATACGCCGATGCAGTTGGCTCAGTATGTAGCAACTATTGCAAATAATGGTGTT
CGTGTGGCTCCTCGTATTGTTGAAGGCATTTATGGTAATAATGATAAGGGAGGACTGGGT
GACTTGATTCAGCAACTGCAACCGACAGAGATGAATAAGGTCAATATATCCGACTCCGAT
ATGAGCATCTTGCACCAAGGTTTTTATCAGGTTGCCCATGGTACTAGTGGATTGACAACT
GGACGTGCCTTTTCAAATGGTGCCTTGGTATCCATTAGCGGAAAAACAGGTACAGCCGAA
AGCTATGTGGCAGATGGTCAGCAAGCAACCAATACCAATGCGGTGGCCTATGCCCCATCT
GATAATCCCCAAATCGCTGTCGCAGTGGTCTTTCCTCATAATACCAATCTAACAAATGGT
GTAGGACCTTCCATTGCGCGTGACATTATCAATCTGTATCAAAAATACCATCCAATGAAT
TAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A3M5
UniProtKB Entry NamePBP2_STRPN
GenBank Protein ID14973165
GenBank Gene IDAE005672
General References
  1. Tettelin H, Nelson KE, Paulsen IT, Eisen JA, Read TD, Peterson S, Heidelberg J, DeBoy RT, Haft DH, Dodson RJ, Durkin AS, Gwinn M, Kolonay JF, Nelson WC, Peterson JD, Umayam LA, White O, Salzberg SL, Lewis MR, Radune D, Holtzapple E, Khouri H, Wolf AM, Utterback TR, Hansen CL, McDonald LA, Feldblyum TV, Angiuoli S, Dickinson T, Hickey EK, Holt IE, Loftus BJ, Yang F, Smith HO, Venter JC, Dougherty BA, Morrison DA, Hollingshead SK, Fraser CM: Complete genome sequence of a virulent isolate of Streptococcus pneumoniae. Science. 2001 Jul 20;293(5529):498-506. [PubMed:11463916]
  2. Dowson CG, Hutchison A, Spratt BG: Extensive re-modelling of the transpeptidase domain of penicillin-binding protein 2B of a penicillin-resistant South African isolate of Streptococcus pneumoniae. Mol Microbiol. 1989 Jan;3(1):95-102. [PubMed:2654541]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05659Faropenem medoxomilinvestigationalunknownDetails
DB01150CefprozilapprovedyesinhibitorDetails
DB01147Cloxacillinapproved, investigational, vet_approvedyesinhibitorDetails