Penicillin-binding protein 2B

Details

Name
Penicillin-binding protein 2B
Synonyms
  • pbp2b
Gene Name
penA
Organism
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Amino acid sequence
>lcl|BSEQ0006970|Penicillin-binding protein 2B
MRKFNSHSIPIRLNLLFSIVILLFMTIIGRLLYMQVLNKDFYEKKLASASQTKITSSSAR
GEIYDASGKPLVENTLKQVVSFTRSNKMTATDLKETAKKLLTYVSISSPNLTERQLADYY
LADPEIYKKIVEALPSEKRLDSDGNRLSESELYNNAVDSVQTSQLNYTEDEKKEIYLFSQ
LNAVGNFATGTIATDPLNDSQVAVIASISKEMPGISISTSWDRKVLETSLSSIVGSVSSE
KAGLPAEEAEAYLKKGYSLNDRVGTSYLEKQYEETLQGKRSVKEIHLDKYGNMESVDTIE
EGSKGNNIKLTIDLAFQDSVDALLKSYFNSELENGGAKYSEGVYAVALNPKTGAVLSMSG
IKHDLKTGELTPDSLGTVTNVFVPGSVVKAATISSGWENGVLSGNQTLTDQSIVFQGSAP
INSWYTQAYGSFPITAVQALEYSSNTYMVQTALGLMGQTYQPNMFVGTSNLESAMEKLRS
TFGEYGLGTATGIDLPDESTGFVPKEYSFANYITNAFGQFDNYTPMQLAQYVATIANNGV
RVAPRIVEGIYGNNDKGGLGDLIQQLQPTEMNKVNISDSDMSILHQGFYQVAHGTSGLTT
GRAFSNGALVSISGKTGTAESYVADGQQATNTNAVAYAPSDNPQIAVAVVFPHNTNLTNG
VGPSIARDIINLYQKYHPMN
Number of residues
680
Molecular Weight
73872.305
Theoretical pI
4.85
GO Classification
Functions
penicillin binding
Processes
cell wall organization / peptidoglycan biosynthetic process / regulation of cell shape / response to antibiotic
Components
integral component of membrane / plasma membrane
General Function
Not Available
Specific Function
Penicillin binding
Pfam Domain Function
Transmembrane Regions
9-29
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0017168|Penicillin-binding protein 2B (penA)
ATGAGACTGATTTGTATGAGAAAATTTAACAGCCATTCGATTCCGATTCGGCTTAATTTA
TTGTTTTCAATCGTCATTTTACTCTTTATGACCATTATTGGTCGTTTGTTGTATATGCAG
GTTTTGAACAAGGATTTTTACGAAAAAAAGCTAGCCTCAGCTAGTCAGACCAAGATTACA
AGCAGTTCAGCCCGTGGGGAAATTTATGATGCTAGTGGAAAACCTTTGGTAGAAAATACG
TTAAAGCAGGTTGTTTCCTTTACGCGTAGCAATAAAATGACGGCTACAGACTTAAAAGAA
ACAGCTAAAAAGTTACTGACTTATGTGAGCATCAGTTCTCCAAATTTGACAGAACGCCAG
CTGGCGGATTACTATTTGGCTGATCCTGAAATCTATAAAAAAATAGTGGAAGCTCTCCCA
AGCGAGAAACGCTTGGATTCAGATGGCAATCGTCTATCCGAATCAGAACTGTATAACAAT
GCGGTCGATAGTGTACAAACGAGTCAACTAAACTATACAGAGGATGAAAAGAAAGAAATC
TATCTTTTTAGTCAGTTAAATGCTGTTGGAAACTTTGCGACAGGAACCATTGCTACAGAT
CCTCTAAATGATTCTCAGGTGGCTGTTATTGCCTCTATTTCAAAGGAGATGCCTGGCATT
AGTATTTCTACTTCTTGGGATAGAAAGGTTTTGGAAACTTCCCTTTCTTCTATAGTTGGG
AGTGTATCCAGTGAAAAAGCTGGTCTCCCAGCGGAAGAAGCAGAAGCCTATCTTAAAAAA
GGCTATTCTCTAAATGACCGTGTAGGAACCTCCTATTTGGAAAAGCAATATGAAGAGACC
TTACAAGGAAAACGCTCGGTAAAAGAAATCCATCTGGATAAATATGGCAATATGGAAAGC
GTGGATACAATTGAGGAAGGTAGTAAGGGAAACAATATCAAACTGACCATTGATTTGGCT
TTCCAAGATAGCGTGGATGCTTTACTGAAAAGTTATTTCAATTCTGAGCTAGAAAATGGT
GGAGCCAAGTATTCTGAAGGTGTCTATGCAGTCGCCCTTAACCCAAAAACAGGTGCGGTT
TTGTCTATGTCAGGGATTAAACATGACTTGAAAACGGGAGAGTTGACGCCTGATTCCTTG
GGAACGGTAACCAATGTCTTTGTTCCAGGTTCGGTTGTCAAGGCGGCGACCATCAGCTCA
GGTTGGGAAAATGGAGTCTTGTCAGGAAACCAGACCTTGACAGACCAGTCCATTGTCTTC
CAAGGTTCAGCTCCCATCAATTCTTGGTATACTCAGGCTTACGGTTCATTCCCTATCACA
GCGGTCCAAGCTCTGGAGTATTCATCAAATACCTATATGGTCCAAACAGCCTTAGGTCTT
ATGGGGCAAACCTATCAACCCAATATGTTTGTCGGCACCAGCAATCTAGAGTCTGCTATG
GAGAAACTGCGTTCAACCTTTGGCGAATATGGCTTGGGTACTGCGACAGGAATTGACCTA
CCAGATGAATCTACTGGATTTGTTCCCAAAGAGTATAGCTTTGCTAATTACATTACTAAT
GCCTTTGGGCAGTTTGATAACTATACGCCGATGCAGTTGGCTCAGTATGTAGCAACTATT
GCAAATAATGGTGTTCGTGTGGCTCCTCGTATTGTTGAAGGCATTTATGGTAATAATGAT
AAGGGAGGACTGGGTGACTTGATTCAGCAACTGCAACCGACAGAGATGAATAAGGTCAAT
ATATCCGACTCCGATATGAGCATCTTGCACCAAGGTTTTTATCAGGTTGCCCATGGTACT
AGTGGATTGACAACTGGACGTGCCTTTTCAAATGGTGCCTTGGTATCCATTAGCGGAAAA
ACAGGTACAGCCGAAAGCTATGTGGCAGATGGTCAGCAAGCAACCAATACCAATGCGGTG
GCCTATGCCCCATCTGATAATCCCCAAATCGCTGTCGCAGTGGTCTTTCCTCATAATACC
AATCTAACAAATGGTGTAGGACCTTCCATTGCGCGTGACATTATCAATCTGTATCAAAAA
TACCATCCAATGAATTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A3M6
UniProtKB Entry NamePBP2_STRR6
GenBank Protein ID984233
GenBank Gene IDX16022
General References
  1. Dowson CG, Hutchison A, Spratt BG: Nucleotide sequence of the penicillin-binding protein 2B gene of Streptococcus pneumoniae strain R6. Nucleic Acids Res. 1989 Sep 25;17(18):7518. [PubMed:2798106]
  2. Hoskins J, Alborn WE Jr, Arnold J, Blaszczak LC, Burgett S, DeHoff BS, Estrem ST, Fritz L, Fu DJ, Fuller W, Geringer C, Gilmour R, Glass JS, Khoja H, Kraft AR, Lagace RE, LeBlanc DJ, Lee LN, Lefkowitz EJ, Lu J, Matsushima P, McAhren SM, McHenney M, McLeaster K, Mundy CW, Nicas TI, Norris FH, O'Gara M, Peery RB, Robertson GT, Rockey P, Sun PM, Winkler ME, Yang Y, Young-Bellido M, Zhao G, Zook CA, Baltz RH, Jaskunas SR, Rosteck PR Jr, Skatrud PL, Glass JI: Genome of the bacterium Streptococcus pneumoniae strain R6. J Bacteriol. 2001 Oct;183(19):5709-17. [PubMed:11544234]
  3. Dowson CG, Hutchison A, Spratt BG: Extensive re-modelling of the transpeptidase domain of penicillin-binding protein 2B of a penicillin-resistant South African isolate of Streptococcus pneumoniae. Mol Microbiol. 1989 Jan;3(1):95-102. [PubMed:2654541]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01066Cefditorenapproved, investigationalyesinhibitorDetails
DB01212CeftriaxoneapprovedyesinhibitorDetails
DB01140Cefadroxilapproved, vet_approved, withdrawnyesinhibitorDetails
DB00493CefotaximeapprovedyesinhibitorDetails
DB00319PiperacillinapprovedyesinhibitorDetails
DB00607Nafcillinapproved, investigationalyesinhibitorDetails
DB00415Ampicillinapproved, vet_approvedyesinhibitorDetails
DB00485Dicloxacillinapproved, investigational, vet_approvedyesinhibitorDetails
DB01163Amdinocillininvestigational, withdrawnyesinhibitorDetails
DB01603Meticillinapproved, investigationalyesinhibitorDetails
DB00456Cefalotinapproved, investigational, vet_approvedyesinhibitorDetails
DB00713Oxacillinapproved, investigationalyesinhibitorDetails
DB01331CefoxitinapprovedyesinhibitorDetails
DB00567Cephalexinapproved, investigational, vet_approvedyesinhibitorDetails
DB03313Cephalosporin CexperimentalyesinhibitorDetails
DB08795AzidocillinexperimentalyesinhibitorDetails
DB00739Hetacillinapproved, vet_approved, withdrawnyesinhibitorDetails