30S ribosomal protein S8

Details

Name
30S ribosomal protein S8
Synonyms
Not Available
Gene Name
rpsH
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0019611|30S ribosomal protein S8
MSMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELE
LTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAG
LGGEIICYVA
Number of residues
130
Molecular Weight
14126.435
Theoretical pI
Not Available
GO Classification
Functions
rRNA binding / structural constituent of ribosome
Processes
regulation of mRNA stability / regulation of translation / translation
Components
cytosol / cytosolic small ribosomal subunit
General Function
Structural constituent of ribosome
Specific Function
One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit.Protein S8 is a translational repressor protein, it controls the translation of the spc operon by binding to its mRNA.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0019612|30S ribosomal protein S8 (rpsH)
ATGAGCATGCAAGATCCGATCGCGGATATGCTGACCCGTATCCGTAACGGTCAGGCCGCG
AACAAAGCTGCGGTCACCATGCCTTCCTCCAAGCTGAAAGTGGCAATCGCCAACGTGCTG
AAGGAAGAAGGTTTTATTGAAGATTTTAAAGTTGAAGGCGACACCAAGCCTGAACTGGAA
CTTACTCTGAAGTATTTCCAGGGCAAAGCTGTTGTAGAAAGCATTCAGCGTGTCAGCCGC
CCAGGTCTGCGCATCTATAAACGTAAAGATGAGCTGCCGAAAGTTATGGCGGGTCTGGGT
ATCGCAGTTGTTTCTACCTCTAAAGGTGTTATGACTGATCGTGCAGCGCGCCAGGCTGGT
CTTGGTGGCGAAATTATCTGCTACGTAGCCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A7W7
UniProtKB Entry NameRS8_ECOLI
General References
  1. Cerretti DP, Dean D, Davis GR, Bedwell DM, Nomura M: The spc ribosomal protein operon of Escherichia coli: sequence and cotranscription of the ribosomal protein genes and a protein export gene. Nucleic Acids Res. 1983 May 11;11(9):2599-616. [PubMed:6222285]
  2. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [PubMed:9278503]
  3. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [PubMed:16738553]
  4. Allen G, Wittmann-Liebold B: The amino acid sequence of the ribosomal protein S8 of Escherichia coli. Hoppe Seylers Z Physiol Chem. 1978 Nov;359(11):1509-25. [PubMed:365698]
  5. Olins PO, Nomura M: Translational regulation by ribosomal protein S8 in Escherichia coli: structural homology between rRNA binding site and feedback target on mRNA. Nucleic Acids Res. 1981 Apr 10;9(7):1757-64. [PubMed:6262737]
  6. Wower I, Kowaleski MP, Sears LE, Zimmermann RA: Mutagenesis of ribosomal protein S8 from Escherichia coli: defects in regulation of the spc operon. J Bacteriol. 1992 Feb;174(4):1213-21. [PubMed:1735715]
  7. VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [PubMed:9298644]
  8. Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [PubMed:10094780]
  9. Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [PubMed:12244297]
  10. Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [PubMed:12809609]
  11. Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [PubMed:16272117]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00759Tetracyclineapproved, vet_approvedyesinhibitorDetails
DB09093Chlortetracyclineapproved, investigational, vet_approvedyesinhibitorDetails
DB12455Omadacyclineapproved, investigationalyesinhibitorDetails