tRNA (guanine-N(1)-)-methyltransferase

Details

Name
tRNA (guanine-N(1)-)-methyltransferase
Synonyms
  • 2.1.1.228
  • M1G-methyltransferase
  • tRNA [GM37] methyltransferase
Gene Name
trmD
Organism
Shigella flexneri
Amino acid sequence
>lcl|BSEQ0011803|tRNA (guanine-N(1)-)-methyltransferase
MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGM
LMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDE
RVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHEASATEDSFAEGLLDCPH
YTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENLALTEEQARLLAEF
KTEHAQQQHKHDGMA
Number of residues
255
Molecular Weight
28422.12
Theoretical pI
5.59
GO Classification
Functions
tRNA (guanine(37)-N(1))-methyltransferase activity
Components
cytoplasm
General Function
Trna (guanine(37)-n(1))-methyltransferase activity
Specific Function
Specifically methylates guanosine-37 in various tRNAs.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0011804|tRNA (guanine-N(1)-)-methyltransferase (trmD)
ATGTGGATTGGCATAATTAGCCTGTTTCCTGAAATGTTCCGCGCAATTACCGATTACGGG
GTAACTGGCCGGGCAGTTAAAAATGGCCTGCTGAGCATCCAGAGTTGGAGTCCTCGCGAC
TTCACGCATGACCGGCACCGTACCGTGGACGATCGTCCTTACGGCGGCGGACCGGGGATG
TTAATGATGGTGCAACCCTTGCGGGACGCCATTCATGCAGCAAAAGCCGCGGCGGGTGAA
GGCGCAAAGGTGATTTATCTGTCACCACAGGGACGCAAGCTTGATCAAGCGGGCGTCAGC
GAACTGGCAACGAATCAAAAATTGATTCTGGTGTGCGGTCGCTACGAAGGTATAGATGAG
CGCGTGATCCAAACCGAAATTGACGAAGAATGGTCAATCGGCGATTACGTTCTCAGTGGT
GGTGAGTTACCAGCAATGACGCTGATTGACTCCGTTTCCCGGTTTATTCCGGGAGTACTG
GGACATGAAGCCTCGGCAACGGAAGATTCCTTTGCTGAAGGATTGCTGGATTGCCCGCAC
TATACGCGGCCTGAGGTGTTAGAAGGGATGGAAGTTCCGCCAGTGTTACTGTCGGGCAAC
CATGCCGAGATACGTCGCTGGCGTTTGAAACAGTCGCTGGGCCGTACCTGGCTTAGAAGA
CCTGAACTTCTGGAAAACCTGGCTCTGACTGAAGAGCAAGCAAGGTTGCTGGCGGAGTTC
AAAACGGAACACGCACAACAGCAACATAAACATGATGGGATGGCGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A876
UniProtKB Entry NameTRMD_SHIFL
GenBank Gene IDAE005674
General References
  1. Jin Q, Yuan Z, Xu J, Wang Y, Shen Y, Lu W, Wang J, Liu H, Yang J, Yang F, Zhang X, Zhang J, Yang G, Wu H, Qu D, Dong J, Sun L, Xue Y, Zhao A, Gao Y, Zhu J, Kan B, Ding K, Chen S, Cheng H, Yao Z, He B, Chen R, Ma D, Qiang B, Wen Y, Hou Y, Yu J: Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157. Nucleic Acids Res. 2002 Oct 15;30(20):4432-41. [PubMed:12384590]
  2. Wei J, Goldberg MB, Burland V, Venkatesan MM, Deng W, Fournier G, Mayhew GF, Plunkett G 3rd, Rose DJ, Darling A, Mau B, Perna NT, Payne SM, Runyen-Janecky LJ, Zhou S, Schwartz DC, Blattner FR: Complete genome sequence and comparative genomics of Shigella flexneri serotype 2a strain 2457T. Infect Immun. 2003 May;71(5):2775-86. [PubMed:12704152]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails