D-alanyl-D-alanine carboxypeptidase DacA

Details

Name
D-alanyl-D-alanine carboxypeptidase DacA
Synonyms
  • 3.4.16.4
  • DD-carboxypeptidase
  • PBP-5
  • Penicillin-binding protein 5
Gene Name
dacA
Organism
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Amino acid sequence
>lcl|BSEQ0016801|D-alanyl-D-alanine carboxypeptidase DacA
MNTIFSARIMKRLALTTALCTAFISAAHADDLNIKTMIPGVPQIDAESYILIDYNSGKVL
AEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDAWATGNPVFKGSSLMFL
KPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKNTHFQTVH
GLDADGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNGIRQLNRNGLLWDNSLNVDG
IKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAESKKLLTWGFRFFETVNPLKV
GKEFASEPVWFGDSDRASLGVDKDVYLTIPRGRMKDLKASYVLNSSELHAPLQKNQVVGT
INFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFHHWFG
Number of residues
403
Molecular Weight
44443.62
Theoretical pI
8.58
GO Classification
Functions
serine-type D-Ala-D-Ala carboxypeptidase activity
Processes
cell wall organization / peptidoglycan biosynthetic process / regulation of cell shape
Components
plasma membrane
General Function
Removes C-terminal D-alanyl residues from sugar-peptide cell wall precursors.
Specific Function
Serine-type d-ala-d-ala carboxypeptidase activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell inner membrane
Gene sequence
>lcl|BSEQ0016802|D-alanyl-D-alanine carboxypeptidase DacA (dacA)
ATGAATACCATTTTTTCCGCTCGTATCATGAAGCGCCTGGCGCTCACCACGGCTCTTTGC
ACAGCCTTTATCTCTGCTGCACATGCCGATGACCTGAATATCAAAACCATGATCCCGGGT
GTACCGCAGATCGACGCGGAGTCCTACATCCTGATTGACTACAACTCCGGCAAAGTACTC
GCCGAACAGAACGCTGATGTCCGCCGCGATCCTGCCAGCCTGACCAAAATGATGACCAGT
TACGTTATCGGCCAGGCAATGAAAGCCGGTAAATTTAAAGAAACTGATTTAGTCACTATC
GGCAACGACGCATGGGCCACCGGTAACCCGGTGTTTAAAGGTTCTTCGCTGATGTTCCTC
AAACCGGGCATGCAGGTTCCGGTTTCTCAGCTGATCCGCGGTATTAACCTGCAATCGGGT
AACGATGCTTGTGTCGCCATGGCCGATTTTGCCGCTGGTAGCCAGGACGCTTTTGTTGGC
TTGATGAACAGCTACGTTAACGCCCTGGGCCTGAAAAATACCCACTTCCAGACGGTACAC
GGTCTGGATGCTGATGGTCAGTACAGCTCCGCGCGAGATATGGCGCTGATCGGCCAGGCG
TTGATCCGTGACGTACCGAATGAATACTCGATCTATAAAGAAAAAGAATTTACGTTTAAC
GGTATTCGCCAGCTGAACCGTAACGGCCTGTTATGGGATAACAGCCTGAATGTCGACGGC
ATCAAAACCGGACACACTGACAAAGCAGGGTACAACCTTGTTGCTTCTGCGACTGAAGGC
CAGATGCGCTTGATCTCTGCGGTGATGGGCGGACGTACTTTTAAAGGCCGTGAAGCCGAA
AGTAAAAAATTGCTAACCTGGGGCTTCCGTTTCTTCGAAACCGTTAACCCACTGAAAGTA
GGTAAAGAGTTCGCCTCTGAACCGGTTTGGTTTGGTGATTCTGATCGCGCTTCGTTAGGG
GTTGATAAAGACGTGTACCTGACCATTCCGCGTGGTCGCATGAAAGATCTGAAAGCCAGC
TATGTGCTGAACAGCAGTGAATTGCATGCGCCGCTGCAAAAGAATCAGGTCGTCGGAACT
ATCAACTTCCAGCTTGATGGCAAAACGATCGAACAACGCCCGCTGGTTGTGCTGCAAGAA
ATACCGGAAGGTAACTTCTTCGGCAAAATCATTGATTACATTAAATTAATGTTCCATCAC
TGGTTTGGTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0AEB3
UniProtKB Entry NameDACA_ECOL6
GenBank Gene IDAE014075
General References
  1. Welch RA, Burland V, Plunkett G 3rd, Redford P, Roesch P, Rasko D, Buckles EL, Liou SR, Boutin A, Hackett J, Stroud D, Mayhew GF, Rose DJ, Zhou S, Schwartz DC, Perna NT, Mobley HL, Donnenberg MS, Blattner FR: Extensive mosaic structure revealed by the complete genome sequence of uropathogenic Escherichia coli. Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):17020-4. Epub 2002 Dec 5. [PubMed:12471157]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04647BOC-GAMMA-D-GLU-L-LYS(CBZ)-D-BOROALAexperimentalunknownDetails
DB01147Cloxacillinapproved, investigational, vet_approvedunknowninhibitorDetails