7-alpha-hydroxysteroid dehydrogenase

Details

Name
7-alpha-hydroxysteroid dehydrogenase
Synonyms
  • 1.1.1.159
  • 7-alpha-HSDH
  • hsdH
Gene Name
hdhA
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0011440|7-alpha-hydroxysteroid dehydrogenase
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGG
QAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVF
SFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEK
NIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVS
GQILTVSGGGVQELN
Number of residues
255
Molecular Weight
26778.32
Theoretical pI
5.04
GO Classification
Functions
cholate 7-alpha-dehydrogenase activity / identical protein binding
Processes
bile acid catabolic process / protein homotetramerization
Components
cytosol
General Function
Identical protein binding
Specific Function
7-alpha-dehydroxylation of cholic acid, yielding deoxycholic acid and lithocholic acid, respectively. Highest affinity with taurochenodeoxycholic acid.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0011441|7-alpha-hydroxysteroid dehydrogenase (hdhA)
GTGTTTAATTCTGACAACCTGAGACTCGACGGAAAATGCGCCATCATCACAGGTGCGGGT
GCAGGTATTGGTAAAGAAATCGCCATTACATTCGCGACAGCTGGCGCATCTGTGGTGGTC
AGTGATATTAACGCCGACGCAGCTAACCATGTTGTAGACGAAATTCAACAACTGGGTGGT
CAGGCATTTGCCTGCCGTTGTGATATTACTTCCGAACAGGAACTCTCTGCACTGGCAGAC
TTTGCTATCAGTAAGCTGGGTAAAGTTGATATTCTGGTTAACAACGCCGGTGGCGGTGGA
CCTAAACCGTTTGATATGCCAATGGCGGATTTTCGCCGTGCTTATGAACTGAATGTGTTT
TCTTTTTTCCATCTGTCACAACTTGTTGCGCCAGAAATGGAAAAAAATGGCGGTGGCGTT
ATTCTGACCATCACTTCTATGGCGGCAGAAAATAAAAATATAAACATGACTTCCTATGCA
TCATCTAAAGCTGCGGCCAGTCATCTGGTCAGAAATATGGCGTTTGACCTGGGTGAAAAA
AATATTCGGGTAAATGGCATTGCGCCGGGGGCAATATTAACCGATGCCCTGAAATCCGTT
ATTACACCAGAAATTGAACAAAAAATGTTACAGCACACGCCGATCAGACGTCTGGGCCAA
CCGCAAGATATTGCTAACGCAGCGCTGTTCCTTTGCTCGCCTGCTGCGAGCTGGGTAAGC
GGACAAATTCTCACCGTCTCCGGTGGTGGGGTACAGGAGCTCAATTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0AET8
UniProtKB Entry NameHDHA_ECOLI
GenBank Protein ID912437
GenBank Gene IDD10497
General References
  1. Yoshimoto T, Higashi H, Kanatani A, Lin XS, Nagai H, Oyama H, Kurazono K, Tsuru D: Cloning and sequencing of the 7 alpha-hydroxysteroid dehydrogenase gene from Escherichia coli HB101 and characterization of the expressed enzyme. J Bacteriol. 1991 Apr;173(7):2173-9. [PubMed:2007545]
  2. Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al.: A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map. DNA Res. 1996 Dec 31;3(6):363-77. [PubMed:9097039]
  3. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [PubMed:9278503]
  4. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [PubMed:16738553]
  5. Tanabe T, Tanaka N, Uchikawa K, Kabashima T, Ito K, Nonaka T, Mitsui Y, Tsuru M, Yoshimoto T: Roles of the Ser146, Tyr159, and Lys163 residues in the catalytic action of 7alpha-hydroxysteroid dehydrogenase from Escherichia coli. J Biochem. 1998 Sep;124(3):634-41. [PubMed:9722677]
  6. Tanaka N, Nonaka T, Tanabe T, Yoshimoto T, Tsuru D, Mitsui Y: Crystal structures of the binary and ternary complexes of 7 alpha-hydroxysteroid dehydrogenase from Escherichia coli. Biochemistry. 1996 Jun 18;35(24):7715-30. [PubMed:8672472]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02123Glycochenodeoxycholic AcidexperimentalunknownDetails