30S ribosomal protein S14

Details

Name
30S ribosomal protein S14
Synonyms
Not Available
Gene Name
rpsN
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0017192|30S ribosomal protein S14
MAKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQ
RNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
Number of residues
101
Molecular Weight
11580.36
Theoretical pI
11.75
GO Classification
Functions
rRNA binding / structural constituent of ribosome
Processes
translation
Components
cytosolic small ribosomal subunit
General Function
Structural constituent of ribosome
Specific Function
Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0017193|30S ribosomal protein S14 (rpsN)
ATGGCTAAGCAATCAATGAAAGCACGCGAAGTAAAACGCGTAGCTTTAGCTGATAAATAC
TTCGCGAAACGCGCTGAACTGAAAGCGATCATCTCTGATGTGAACGCTTCCGACGAAGAT
CGTTGGAACGCTGTTCTCAAGCTGCAGACTCTGCCGCGTGATTCCAGCCCGTCTCGTCAG
CGTAACCGCTGCCGTCAAACAGGTCGTCCGCATGGTTTCCTGCGGAAGTTCGGGTTGAGC
CGTATTAAGGTCCGTGAAGCCGCTATGCGCGGTGAAATCCCGGGTCTGAAAAAGGCTAGC
TGGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0AG59
UniProtKB Entry NameRS14_ECOLI
GenBank Protein ID809690
GenBank Gene IDX01563
General References
  1. Cerretti DP, Dean D, Davis GR, Bedwell DM, Nomura M: The spc ribosomal protein operon of Escherichia coli: sequence and cotranscription of the ribosomal protein genes and a protein export gene. Nucleic Acids Res. 1983 May 11;11(9):2599-616. [PubMed:6222285]
  2. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [PubMed:9278503]
  3. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [PubMed:16738553]
  4. Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [PubMed:10094780]
  5. Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [PubMed:12244297]
  6. Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [PubMed:12809609]
  7. Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [PubMed:16272117]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00560TigecyclineapprovedyesadductDetails
DB00759Tetracyclineapproved, vet_approvedyesinhibitorDetails
DB09093Chlortetracyclineapproved, investigational, vet_approvedyesinhibitorDetails
DB12615Plazomicinapproved, investigationalunknowninhibitorDetails
DB12455Omadacyclineapproved, investigationalyesinhibitorDetails