Ig lambda-1 chain C regions
Details
- Name
- Ig lambda-1 chain C regions
- Synonyms
- Not Available
- Gene Name
- IGLC1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0009386|Ig lambda-1 chain C regions GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSK QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
- Number of residues
- 106
- Molecular Weight
- 11347.585
- Theoretical pI
- Not Available
- GO Classification
- Functionsantigen binding / immunoglobulin receptor bindingProcessesB cell receptor signaling pathway / complement activation / complement activation, classical pathway / defense response to bacterium / Fc-epsilon receptor signaling pathway / Fc-gamma receptor signaling pathway involved in phagocytosis / immune response / innate immune response / phagocytosis, engulfment / phagocytosis, recognition / positive regulation of B cell activation / receptor-mediated endocytosis / regulation of immune responseComponentsblood microparticle / external side of plasma membrane / extracellular exosome / extracellular region / extracellular space / immunoglobulin complex, circulating / plasma membrane
- General Function
- Immunoglobulin receptor binding
- Specific Function
- Not Available
- Pfam Domain Function
- C1-set (PF07654)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0CG04 UniProtKB Entry Name LAC1_HUMAN HGNC ID HGNC:5855 - General References
- Fett JW, Deutsch HF: Primary structure of the Mcg lambda chain. Biochemistry. 1974 Sep 24;13(20):4102-14. [Article]
- Vasicek TJ, Leder P: Structure and expression of the human immunoglobulin lambda genes. J Exp Med. 1990 Aug 1;172(2):609-20. [Article]
- Hieter PA, Hollis GF, Korsmeyer SJ, Waldmann TA, Leder P: Clustered arrangement of immunoglobulin lambda constant region genes in man. Nature. 1981 Dec 10;294(5841):536-40. [Article]
- Azkargorta M, Soria J, Ojeda C, Guzman F, Acera A, Iloro I, Suarez T, Elortza F: Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification. J Proteome Res. 2015 Jun 5;14(6):2649-58. doi: 10.1021/acs.jproteome.5b00179. Epub 2015 May 20. [Article]
- Ely KR, Herron JN, Harker M, Edmundson AB: Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms. J Mol Biol. 1989 Dec 5;210(3):601-15. [Article]