Apoptosis regulator Bcl-2

Details

Name
Apoptosis regulator Bcl-2
Synonyms
Not Available
Gene Name
BCL2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0000491|Apoptosis regulator Bcl-2
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Number of residues
239
Molecular Weight
26265.66
Theoretical pI
7.32
GO Classification
Functions
BH3 domain binding / channel activity / channel inhibitor activity / identical protein binding / protease binding / protein heterodimerization activity / protein homodimerization activity / sequence-specific DNA binding / ubiquitin protein ligase binding
Processes
actin filament organization / apoptotic process / axon regeneration / axonogenesis / B cell homeostasis / B cell lineage commitment / B cell proliferation / B cell receptor signaling pathway / behavioral fear response / branching involved in ureteric bud morphogenesis / CD8-positive, alpha-beta T cell lineage commitment / cell aging / cell growth / cellular response to DNA damage stimulus / cellular response to glucose starvation / cellular response to hypoxia / cellular response to organic substance / cochlear nucleus development / defense response to virus / digestive tract morphogenesis / ear development / endoplasmic reticulum calcium ion homeostasis / extrinsic apoptotic signaling pathway in absence of ligand / extrinsic apoptotic signaling pathway via death domain receptors / female pregnancy / focal adhesion assembly / gland morphogenesis / glomerulus development / hair follicle morphogenesis / homeostasis of number of cells within a tissue / humoral immune response / innate immune response / intrinsic apoptotic signaling pathway / intrinsic apoptotic signaling pathway in response to DNA damage / intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress / intrinsic apoptotic signaling pathway in response to oxidative stress / lymphoid progenitor cell differentiation / male gonad development / melanin metabolic process / melanocyte differentiation / mesenchymal cell development / metanephros development / negative regulation of anoikis / negative regulation of apoptotic process / negative regulation of apoptotic signaling pathway / negative regulation of autophagy / negative regulation of calcium ion transport into cytosol / negative regulation of cell growth / negative regulation of cell migration / negative regulation of cellular pH reduction / negative regulation of extrinsic apoptotic signaling pathway in absence of ligand / negative regulation of G1/S transition of mitotic cell cycle / negative regulation of intrinsic apoptotic signaling pathway / negative regulation of mitochondrial depolarization / negative regulation of myeloid cell apoptotic process / negative regulation of neuron apoptotic process / negative regulation of ossification / negative regulation of osteoblast proliferation / negative regulation of reactive oxygen species metabolic process / negative regulation of retinal cell programmed cell death / neuron apoptotic process / nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway / oocyte development / organ growth / ossification / ovarian follicle development / peptidyl-serine phosphorylation / peptidyl-threonine phosphorylation / pigment granule organization / positive regulation of B cell proliferation / positive regulation of catalytic activity / positive regulation of cell growth / positive regulation of intrinsic apoptotic signaling pathway / positive regulation of melanocyte differentiation / positive regulation of multicellular organism growth / positive regulation of neuron maturation / positive regulation of peptidyl-serine phosphorylation / positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway / positive regulation of skeletal muscle fiber development / positive regulation of smooth muscle cell migration / post-embryonic development / programmed cell death / protein dephosphorylation / protein polyubiquitination / reactive oxygen species metabolic process / regulation of calcium ion transport / regulation of cell-matrix adhesion / regulation of gene expression / regulation of glycoprotein biosynthetic process / regulation of mitochondrial membrane permeability / regulation of mitochondrial membrane potential / regulation of nitrogen utilization / regulation of protein heterodimerization activity / regulation of protein homodimerization activity / regulation of protein stability / regulation of transmembrane transporter activity / regulation of viral genome replication / release of cytochrome c from mitochondria / renal system process / response to cytokine / response to drug / response to gamma radiation / response to glucocorticoid / response to hydrogen peroxide / response to iron ion / response to ischemia / response to nicotine / response to radiation / response to toxic substance / response to UV-B / spleen development / T cell differentiation in thymus / T cell homeostasis / thymus development / transmembrane transport
Components
cytoplasm / cytosol / endoplasmic reticulum / endoplasmic reticulum membrane / membrane / mitochondrial outer membrane / mitochondrion / myelin sheath / nuclear membrane / nucleus / pore complex
General Function
Ubiquitin protein ligase binding
Specific Function
Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (PubMed:17418785).
Pfam Domain Function
Transmembrane Regions
212-233
Cellular Location
Mitochondrion outer membrane
Gene sequence
>lcl|BSEQ0021924|Apoptosis regulator Bcl-2 (BCL2)
ATGGCGCACGCTGGGAGAACAGGGTACGATAACCGGGAGATAGTGATGAAGTACATCCAT
TATAAGCTGTCGCAGAGGGGCTACGAGTGGGATGCGGGAGATGTGGGCGCCGCGCCCCCG
GGGGCCGCCCCCGCACCGGGCATCTTCTCCTCCCAGCCCGGGCACACGCCCCATCCAGCC
GCATCCCGGGACCCGGTCGCCAGGACCTCGCCGCTGCAGACCCCGGCTGCCCCCGGCGCC
GCCGCGGGGCCTGCGCTCAGCCCGGTGCCACCTGTGGTCCACCTGACCCTCCGCCAGGCC
GGCGACGACTTCTCCCGCCGCTACCGCCGCGACTTCGCCGAGATGTCCAGCCAGCTGCAC
CTGACGCCCTTCACCGCGCGGGGACGCTTTGCCACGGTGGTGGAGGAGCTCTTCAGGGAC
GGGGTGAACTGGGGGAGGATTGTGGCCTTCTTTGAGTTCGGTGGGGTCATGTGTGTGGAG
AGCGTCAACCGGGAGATGTCGCCCCTGGTGGACAACATCGCCCTGTGGATGACTGAGTAC
CTGAACCGGCACCTGCACACCTGGATCCAGGATAACGGAGGCTGGGATGCCTTTGTGGAA
CTGTACGGCCCCAGCATGCGGCCTCTGTTTGATTTCTCCTGGCTGTCTCTGAAGACTCTG
CTCAGTTTGGCCCTGGTGGGAGCTTGCATCACCCTGGGTGCCTATCTGGGCCACAAGTGA
Chromosome Location
18
Locus
18q21.33|18q21.3
External Identifiers
ResourceLink
UniProtKB IDP10415
UniProtKB Entry NameBCL2_HUMAN
GenBank Protein ID179367
GenBank Gene IDM13994
GenAtlas IDBCL2
HGNC IDHGNC:990
General References
  1. Tsujimoto Y, Croce CM: Analysis of the structure, transcripts, and protein products of bcl-2, the gene involved in human follicular lymphoma. Proc Natl Acad Sci U S A. 1986 Jul;83(14):5214-8. [PubMed:3523487]
  2. Eguchi Y, Ewert DL, Tsujimoto Y: Isolation and characterization of the chicken bcl-2 gene: expression in a variety of tissues including lymphoid and neuronal organs in adult and embryo. Nucleic Acids Res. 1992 Aug 25;20(16):4187-92. [PubMed:1508712]
  3. Cleary ML, Smith SD, Sklar J: Cloning and structural analysis of cDNAs for bcl-2 and a hybrid bcl-2/immunoglobulin transcript resulting from the t(14;18) translocation. Cell. 1986 Oct 10;47(1):19-28. [PubMed:2875799]
  4. Seto M, Jaeger U, Hockett RD, Graninger W, Bennett S, Goldman P, Korsmeyer SJ: Alternative promoters and exons, somatic mutation and deregulation of the Bcl-2-Ig fusion gene in lymphoma. EMBO J. 1988 Jan;7(1):123-31. [PubMed:2834197]
  5. Hua C, Zorn S, Jensen JP, Coupland RW, Ko HS, Wright JJ, Bakhshi A: Consequences of the t(14;18) chromosomal translocation in follicular lymphoma: deregulated expression of a chimeric and mutated BCL-2 gene. Oncogene Res. 1988 Feb;2(3):263-75. [PubMed:3285301]
  6. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. [PubMed:16177791]
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  8. Tanaka S, Louie DC, Kant JA, Reed JC: Frequent incidence of somatic mutations in translocated BCL2 oncogenes of non-Hodgkin's lymphomas. Blood. 1992 Jan 1;79(1):229-37. [PubMed:1339299]
  9. Hockenbery D, Nunez G, Milliman C, Schreiber RD, Korsmeyer SJ: Bcl-2 is an inner mitochondrial membrane protein that blocks programmed cell death. Nature. 1990 Nov 22;348(6299):334-6. [PubMed:2250705]
  10. Yin XM, Oltvai ZN, Korsmeyer SJ: BH1 and BH2 domains of Bcl-2 are required for inhibition of apoptosis and heterodimerization with Bax. Nature. 1994 May 26;369(6478):321-3. [PubMed:8183370]
  11. Takayama S, Bimston DN, Matsuzawa S, Freeman BC, Aime-Sempe C, Xie Z, Morimoto RI, Reed JC: BAG-1 modulates the chaperone activity of Hsp70/Hsc70. EMBO J. 1997 Aug 15;16(16):4887-96. [PubMed:9305631]
  12. Cheng EH, Kirsch DG, Clem RJ, Ravi R, Kastan MB, Bedi A, Ueno K, Hardwick JM: Conversion of Bcl-2 to a Bax-like death effector by caspases. Science. 1997 Dec 12;278(5345):1966-8. [PubMed:9395403]
  13. Naumovski L, Cleary ML: The p53-binding protein 53BP2 also interacts with Bc12 and impedes cell cycle progression at G2/M. Mol Cell Biol. 1996 Jul;16(7):3884-92. [PubMed:8668206]
  14. Ruvolo PP, Deng X, May WS: Phosphorylation of Bcl2 and regulation of apoptosis. Leukemia. 2001 Apr;15(4):515-22. [PubMed:11368354]
  15. Yamamoto K, Ichijo H, Korsmeyer SJ: BCL-2 is phosphorylated and inactivated by an ASK1/Jun N-terminal protein kinase pathway normally activated at G(2)/M. Mol Cell Biol. 1999 Dec;19(12):8469-78. [PubMed:10567572]
  16. Yu J, Zhang L, Hwang PM, Kinzler KW, Vogelstein B: PUMA induces the rapid apoptosis of colorectal cancer cells. Mol Cell. 2001 Mar;7(3):673-82. [PubMed:11463391]
  17. Qin W, Hu J, Guo M, Xu J, Li J, Yao G, Zhou X, Jiang H, Zhang P, Shen L, Wan D, Gu J: BNIPL-2, a novel homologue of BNIP-2, interacts with Bcl-2 and Cdc42GAP in apoptosis. Biochem Biophys Res Commun. 2003 Aug 22;308(2):379-85. [PubMed:12901880]
  18. Kang CB, Tai J, Chia J, Yoon HS: The flexible loop of Bcl-2 is required for molecular interaction with immunosuppressant FK-506 binding protein 38 (FKBP38). FEBS Lett. 2005 Feb 28;579(6):1469-76. [PubMed:15733859]
  19. Jin S, Zhuo Y, Guo W, Field J: p21-activated Kinase 1 (Pak1)-dependent phosphorylation of Raf-1 regulates its mitochondrial localization, phosphorylation of BAD, and Bcl-2 association. J Biol Chem. 2005 Jul 1;280(26):24698-705. Epub 2005 Apr 22. [PubMed:15849194]
  20. Chintharlapalli SR, Jasti M, Malladi S, Parsa KV, Ballestero RP, Gonzalez-Garcia M: BMRP is a Bcl-2 binding protein that induces apoptosis. J Cell Biochem. 2005 Feb 15;94(3):611-26. [PubMed:15547950]
  21. Portier BP, Taglialatela G: Bcl-2 localized at the nuclear compartment induces apoptosis after transient overexpression. J Biol Chem. 2006 Dec 29;281(52):40493-502. Epub 2006 Nov 7. [PubMed:17090549]
  22. Bruey JM, Bruey-Sedano N, Luciano F, Zhai D, Balpai R, Xu C, Kress CL, Bailly-Maitre B, Li X, Osterman A, Matsuzawa S, Terskikh AV, Faustin B, Reed JC: Bcl-2 and Bcl-XL regulate proinflammatory caspase-1 activation by interaction with NALP1. Cell. 2007 Apr 6;129(1):45-56. [PubMed:17418785]
  23. Wei Y, Pattingre S, Sinha S, Bassik M, Levine B: JNK1-mediated phosphorylation of Bcl-2 regulates starvation-induced autophagy. Mol Cell. 2008 Jun 20;30(6):678-88. doi: 10.1016/j.molcel.2008.06.001. [PubMed:18570871]
  24. Welch C, Santra MK, El-Assaad W, Zhu X, Huber WE, Keys RA, Teodoro JG, Green MR: Identification of a protein, G0S2, that lacks Bcl-2 homology domains and interacts with and antagonizes Bcl-2. Cancer Res. 2009 Sep 1;69(17):6782-9. doi: 10.1158/0008-5472.CAN-09-0128. Epub 2009 Aug 25. [PubMed:19706769]
  25. Eliseev RA, Malecki J, Lester T, Zhang Y, Humphrey J, Gunter TE: Cyclophilin D interacts with Bcl2 and exerts an anti-apoptotic effect. J Biol Chem. 2009 Apr 10;284(15):9692-9. doi: 10.1074/jbc.M808750200. Epub 2009 Feb 19. [PubMed:19228691]
  26. Liu Y, Huo Z, Yan B, Lin X, Zhou ZN, Liang X, Zhu W, Liang D, Li L, Liu Y, Zhao H, Sun Y, Chen YH: Prolyl hydroxylase 3 interacts with Bcl-2 to regulate doxorubicin-induced apoptosis in H9c2 cells. Biochem Biophys Res Commun. 2010 Oct 15;401(2):231-7. doi: 10.1016/j.bbrc.2010.09.037. Epub 2010 Sep 16. [PubMed:20849813]
  27. Chen D, Gao F, Li B, Wang H, Xu Y, Zhu C, Wang G: Parkin mono-ubiquitinates Bcl-2 and regulates autophagy. J Biol Chem. 2010 Dec 3;285(49):38214-23. doi: 10.1074/jbc.M110.101469. Epub 2010 Oct 2. [PubMed:20889974]
  28. Zhang X, Weng C, Li Y, Wang X, Jiang C, Li X, Xu Y, Chen Q, Pan L, Tang H: Human Bop is a novel BH3-only member of the Bcl-2 protein family. Protein Cell. 2012 Oct;3(10):790-801. doi: 10.1007/s13238-012-2069-7. Epub 2012 Oct 11. [PubMed:23055042]
  29. Chiorazzi M, Rui L, Yang Y, Ceribelli M, Tishbi N, Maurer CW, Ranuncolo SM, Zhao H, Xu W, Chan WC, Jaffe ES, Gascoyne RD, Campo E, Rosenwald A, Ott G, Delabie J, Rimsza LM, Shaham S, Staudt LM: Related F-box proteins control cell death in Caenorhabditis elegans and human lymphoma. Proc Natl Acad Sci U S A. 2013 Mar 5;110(10):3943-8. doi: 10.1073/pnas.1217271110. Epub 2013 Feb 19. [PubMed:23431138]
  30. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]
  31. Petros AM, Medek A, Nettesheim DG, Kim DH, Yoon HS, Swift K, Matayoshi ED, Oltersdorf T, Fesik SW: Solution structure of the antiapoptotic protein bcl-2. Proc Natl Acad Sci U S A. 2001 Mar 13;98(6):3012-7. Epub 2001 Feb 27. [PubMed:11248023]
  32. Oltersdorf T, Elmore SW, Shoemaker AR, Armstrong RC, Augeri DJ, Belli BA, Bruncko M, Deckwerth TL, Dinges J, Hajduk PJ, Joseph MK, Kitada S, Korsmeyer SJ, Kunzer AR, Letai A, Li C, Mitten MJ, Nettesheim DG, Ng S, Nimmer PM, O'Connor JM, Oleksijew A, Petros AM, Reed JC, Shen W, Tahir SK, Thompson CB, Tomaselli KJ, Wang B, Wendt MD, Zhang H, Fesik SW, Rosenberg SH: An inhibitor of Bcl-2 family proteins induces regression of solid tumours. Nature. 2005 Jun 2;435(7042):677-81. Epub 2005 May 15. [PubMed:15902208]
  33. Bruncko M, Oost TK, Belli BA, Ding H, Joseph MK, Kunzer A, Martineau D, McClellan WJ, Mitten M, Ng SC, Nimmer PM, Oltersdorf T, Park CM, Petros AM, Shoemaker AR, Song X, Wang X, Wendt MD, Zhang H, Fesik SW, Rosenberg SH, Elmore SW: Studies leading to potent, dual inhibitors of Bcl-2 and Bcl-xL. J Med Chem. 2007 Feb 22;50(4):641-62. Epub 2007 Jan 26. [PubMed:17256834]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01229Paclitaxelapproved, vet_approvedyesinhibitorDetails
DB01248Docetaxelapproved, investigationalunknownDetails
DB01367RasagilineapprovedyesactivatorDetails
DB05297Paclitaxel docosahexaenoic acidinvestigationalunknownDetails
DB08871Eribulinapproved, investigationalunknownDetails
DB12340NavitoclaxinvestigationalunknownDetails
DB06307ApoptoneinvestigationalunknownDetails
DB12191ObatoclaxinvestigationalunknownDetails
DB09401Isosorbideapproved, investigationalunknownDetails
DB01050IbuprofenapprovedunknownmodulatorDetails
DB11581Venetoclaxapproved, investigationalyesinhibitorDetails
DB09213Dexibuprofenapproved, investigationalunknownnegative modulatorDetails
DB06756Glycine betaineapproved, nutraceuticalunknownDetails