Botulinum neurotoxin type B

Details

Name
Botulinum neurotoxin type B
Synonyms
  • 3.4.24.69
  • BoNT/B
  • Bontoxilysin-B
Gene Name
botB
Organism
Clostridium botulinum
Amino acid sequence
>lcl|BSEQ0010882|Botulinum neurotoxin type B
MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERYTFGYKPEDFN
KSSGIFNRDVCEYYDPDYLNTNDKKNIFLQTMIKLFNRIKSKPLGEKLLEMIINGIPYLG
DRRVPLEEFNTNIASVTVNKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNH
FASREGFGGIMQMKFCPEYVSVFNNVQENKGASIFNRRGYFSDPALILMHELIHVLHGLY
GIKVDDLPIVPNEKKFFMQSTDAIQAEELYTFGGQDPSIITPSTDKSIYDKVLQNFRGIV
DRLNKVLVCISDPNININIYKNKFKDKYKFVEDSEGKYSIDVESFDKLYKSLMFGFTETN
IAENYKIKTRASYFSDSLPPVKIKNLLDNEIYTIEEGFNISDKDMEKEYRGQNKAINKQA
YEEISKEHLAVYKIQMCKSVKAPGICIDVDNEDLFFIADKNSFSDDLSKNERIEYNTQSN
YIENDFPINELILDTDLISKIELPSENTESLTDFNVDVPVYEKQPAIKKIFTDENTIFQY
LYSQTFPLDIRDISLTSSFDDALLFSNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIVND
FVIEANKSNTMDKIADISLIVPYIGLALNVGNETAKGNFENAFEIAGASILLEFIPELLI
PVVGAFLLESYIDNKNKIIKTIDNALTKRNEKWSDMYGLIVAQWLSTVNTQFYTIKEGMY
KALNYQAQALEEIIKYRYNIYSEKEKSNINIDFNDINSKLNEGINQAIDNINNFINGCSV
SYLMKKMIPLAVEKLLDFDNTLKKNLLNYIDENKLYLIGSAEYEKSKVNKYLKTIMPFDL
SIYTNDTILIEMFNKYNSEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFK
LTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNS
GWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYING
KLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSY
SEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLY
IGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEKLFLAPISD
SDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCIS
KWYLKEVKRKPYNLKLGCNWQFIPKDEGWTE
Number of residues
1291
Molecular Weight
150801.16
Theoretical pI
4.97
GO Classification
Functions
metalloendopeptidase activity / protein transmembrane transporter activity / zinc ion binding
Processes
inhibition of neurotransmitter uptake / pathogenesis / protein transmembrane transport
Components
extracellular region / host cell cytosol / host cell junction / host cell presynaptic membrane / integral component of membrane
General Function
Zinc ion binding
Specific Function
Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that cleaves the '76-Gln-|-Phe-77' bond of synaptobrevin-2.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0002513|3876 bp
ATGCCAGTTACAATAAATAATTTTAATTATAATGATCCTATTGATAATAATAATATTATT
ATGATGGAGCCTCCATTTGCGAGAGGTACGGGGAGATATTATAAAGCTTTTAAAATCACA
GATCGTATTTGGATAATACCGGAAAGATATACTTTTGGATATAAACCTGAGGATTTTAAT
AAAAGTTCCGGTATTTTTAATAGAGATGTTTGTGAATATTATGATCCAGATTACTTAAAT
ACTAATGATAAAAAGAATATATTTTTACAAACAATGATCAAGTTATTTAATAGAATCAAA
TCAAAACCATTGGGTGAAAAGTTATTAGAGATGATTATAAATGGTATACCTTATCTTGGA
GATAGACGTGTTCCACTCGAAGAGTTTAACACAAACATTGCTAGTGTAACTGTTAATAAA
TTAATCAGTAATCCAGGAGAAGTGGAGCGAAAAAAAGGTATTTTCGCAAATTTAATAATA
TTTGGACCTGGGCCAGTTTTAAATGAAAATGAGACTATAGATATAGGTATACAAAATCAT
TTTGCATCAAGGGAAGGCTTCGGGGGTATAATGCAAATGAAGTTTTGCCCAGAATATGTA
AGCGTATTTAATAATGTTCAAGAAAACAAAGGCGCAAGTATATTTAATAGACGTGGATAT
TTTTCAGATCCAGCCTTGATATTAATGCATGAACTTATACATGTTTTACATGGATTATAT
GGCATTAAAGTAGATGATTTACCAATTGTACCAAATGAAAAAAAATTTTTTATGCAATCT
ACAGATGCTATACAGGCAGAAGAACTATATACATTTGGAGGACAAGATCCCAGCATCATA
ACTCCTTCTACGGATAAAAGTATCTATGATAAAGTTTTGCAAAATTTTAGAGGGATAGTT
GATAGACTTAACAAGGTTTTAGTTTGCATATCAGATCCTAACATTAATATTAATATATAT
AAAAATAAATTTAAAGATAAATATAAATTCGTTGAAGATTCTGAGGGAAAATATAGTATA
GATGTAGAAAGTTTTGATAAATTATATAAAAGCTTAATGTTTGGTTTTACAGAAACTAAT
ATAGCAGAAAATTATAAAATAAAAACTAGAGCTTCTTATTTTAGTGATTCCTTACCACCA
GTAAAAATAAAAAATTTATTAGATAATGAAATCTATACTATAGAGGAAGGGTTTAATATA
TCTGATAAAGATATGGAAAAAGAATATAGAGGTCAGAATAAAGCTATAAATAAACAAGCT
TATGAAGAAATTAGCAAGGAGCATTTGGCTGTATATAAGATACAAATGTGTAAAAGTGTT
AAAGCTCCAGGAATATGTATTGATGTTGATAATGAAGATTTGTTCTTTATAGCTGATAAA
AATAGTTTTTCAGATGATTTATCTAAAAACGAAAGAATAGAATATAATACACAGAGTAAT
TATATAGAAAATGACTTCCCTATAAATGAATTAATTTTAGATACTGATTTAATAAGTAAA
ATAGAATTACCAAGTGAAAATACAGAATCACTTACTGATTTTAATGTAGATGTTCCAGTA
TATGAAAAACAACCCGCTATAAAAAAAATTTTTACAGATGAAAATACCATCTTTCAATAT
TTATACTCTCAGACATTTCCTCTAGATATAAGAGATATAAGTTTAACATCTTCATTTGAT
GATGCATTATTATTTTCTAACAAAGTTTATTCATTTTTTTCTATGGATTATATTAAAACT
GCTAATAAAGTGGTAGAAGCAGGATTATTTGCAGGTTGGGTGAAACAGATAGTAAATGAT
TTTGTAATCGAAGCTAATAAAAGCAATACTATGGATAAAATTGCAGATATATCTCTAATT
GTTCCTTATATAGGATTAGCTTTAAATGTAGGAAATGAAACAGCTAAAGGAAATTTTGAA
AATGCTTTTGAGATTGCAGGAGCCAGTATTCTACTAGAATTTATACCAGAACTTTTAATA
CCTGTAGTTGGAGCCTTTTTATTAGAATCATATATTGACAATAAAAATAAAATTATTAAA
ACAATAGATAATGCTTTAACTAAAAGAAATGAAAAATGGAGTGATATGTACGGATTAATA
GTAGCGCAATGGCTCTCAACAGTTAATACTCAATTTTATACAATAAAAGAGGGAATGTAT
AAGGCTTTAAATTATCAAGCACAAGCATTGGAAGAAATAATAAAATACAGATATAATATA
TATTCTGAAAAAGAAAAGTCAAATATTAACATCGATTTTAATGATATAAATTCTAAACTT
AATGAGGGTATTAACCAAGCTATAGATAATATAAATAATTTTATAAATGGATGTTCTGTA
TCATATTTAATGAAAAAAATGATTCCATTAGCTGTAGAAAAATTACTAGACTTTGATAAT
ACTCTCAAAAAAAATTTGTTAAATTATATAGATGAAAATAAATTATATTTGATTGGAAGT
GCAGAATATGAAAAATCAAAAGTAAATAAATACTTGAAAACCATTATGCCGTTTGATCTT
TCAATATATACCAATGATACAATACTAATAGAAATGTTTAATAAATATAATAGCGAAATT
TTAAATAATATTATCTTAAATTTAAGATATAAGGATAATAATTTAATAGATTTATCAGGA
TATGGGGCAAAGGTAGAGGTATATGATGGAGTCGAGCTTAATGATAAAAATCAATTTAAA
TTAACTAGTTCAGCAAATAGTAAGATTAGAGTGACTCAAAATCAGAATATCATATTTAAT
AGTGTGTTCCTTGATTTTAGCGTTAGCTTTTGGATAAGAATACCTAAATATAAGAATGAT
GGTATACAAAATTATATTCATAATGAATATACAATAATTAATTGTATGAAAAATAATTCG
GGCTGGAAAATATCTATTAGGGGTAATAGGATAATATGGACTTTAATTGATATAAATGGA
AAAACCAAATCGGTATTTTTTGAATATAACATAAGAGAAGATATATCAGAGTATATAAAT
AGATGGTTTTTTGTAACTATTACTAATAATTTGAATAACGCTAAAATTTATATTAATGGT
AAGCTAGAATCAAATACAGATATTAAAGATATAAGAGAAGTTATTGCTAATGGTGAAATA
ATATTTAAATTAGATGGTGATATAGATAGAACACAATTTATTTGGATGAAATATTTCAGT
ATTTTTAATACGGAATTAAGTCAATCAAATATTGAAGAAAGATATAAAATTCAATCATAT
AGCGAATATTTAAAAGATTTTTGGGGAAATCCTTTAATGTACAATAAAGAATATTATATG
TTTAATGCGGGGAATAAAAATTCATATATTAAACTAAAGAAAGATTCACCTGTAGGTGAA
ATTTTAACACGTAGCAAATATAATCAAAATTCTAAATATATAAATTATAGAGATTTATAT
ATTGGAGAAAAATTTATTATAAGAAGAAAGTCAAATTCTCAATCTATAAATGATGATATA
GTTAGAAAAGAAGATTATATATATCTAGATTTTTTTAATTTAAATCAAGAGTGGAGAGTA
TATACCTATAAATATTTTAAGAAAGAGGAAGAAAAATTGTTTTTAGCTCCTATAAGTGAT
TCTGATGAGTTTTACAATACTATACAAATAAAAGAATATGATGAACAGCCAACATATAGT
TGTCAGTTGCTTTTTAAAAAAGATGAAGAAAGTACTGATGAGATAGGATTGATTGGTATT
CATCGTTTCTACGAATCTGGAATTGTATTTGAAGAGTATAAAGATTATTTTTGTATAAGT
AAATGGTACTTAAAAGAGGTAAAAAGGAAACCATATAATTTAAAATTGGGATGTAATTGG
CAGTTTATTCCTAAAGATGAAGGGTGGACTGAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP10844
UniProtKB Entry NameBXB_CLOBO
GenBank Protein ID144735
GenBank Gene IDM81186
General References
  1. Whelan SM, Elmore MJ, Bodsworth NJ, Brehm JK, Atkinson T, Minton NP: Molecular cloning of the Clostridium botulinum structural gene encoding the type B neurotoxin and determination of its entire nucleotide sequence. Appl Environ Microbiol. 1992 Aug;58(8):2345-54. [PubMed:1514783]
  2. Campbell KD, Collins MD, East AK: Gene probes for identification of the botulinal neurotoxin gene and specific identification of neurotoxin types B, E, and F. J Clin Microbiol. 1993 Sep;31(9):2255-62. [PubMed:8408542]
  3. Dasgupta BR, Datta A: Botulinum neurotoxin type B (strain 657): partial sequence and similarity with tetanus toxin. Biochimie. 1988 Jun;70(6):811-7. [PubMed:3139097]
  4. Schiavo G, Rossetto O, Santucci A, DasGupta BR, Montecucco C: Botulinum neurotoxins are zinc proteins. J Biol Chem. 1992 Nov 25;267(33):23479-83. [PubMed:1429690]
  5. Schiavo G, Benfenati F, Poulain B, Rossetto O, Polverino de Laureto P, DasGupta BR, Montecucco C: Tetanus and botulinum-B neurotoxins block neurotransmitter release by proteolytic cleavage of synaptobrevin. Nature. 1992 Oct 29;359(6398):832-5. [PubMed:1331807]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01705Bis(5-Amidino-Benzimidazolyl)MethaneexperimentalunknownDetails
DB03721N-acetyl-alpha-neuraminic acidexperimentalunknownDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails
DB13903Equine Botulinum Neurotoxin B Immune FAB2approved, experimental, investigationalyesantibodyDetails