Hyaluronan and proteoglycan link protein 1

Details

Name
Hyaluronan and proteoglycan link protein 1
Synonyms
  • Cartilage-link protein
  • Cartilage-linking protein 1
  • CRTL1
  • Proteoglycan link protein
Gene Name
HAPLN1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0013369|Hyaluronan and proteoglycan link protein 1
MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLP
CKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDS
DASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQA
CLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGF
WDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILG
YDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Number of residues
354
Molecular Weight
40165.215
Theoretical pI
Not Available
GO Classification
Functions
hyaluronic acid binding
Processes
cell adhesion / central nervous system development / extracellular matrix organization / mitophagy in response to mitochondrial depolarization / skeletal system development
Components
extracellular region / proteinaceous extracellular matrix
General Function
Hyaluronic acid binding
Specific Function
Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0013370|Hyaluronan and proteoglycan link protein 1 (HAPLN1)
ATGAAGAGTCTACTTCTTCTGGTGCTGATTTCAATCTGCTGGGCTGATCATCTTTCAGAC
AACTATACTCTGGATCATGACAGAGCTATTCACATCCAAGCAGAAAATGGCCCCCATCTA
CTTGTGGAAGCAGAGCAAGCCAAGGTGTTTTCACACAGAGGTGGCAATGTTACACTGCCA
TGTAAATTTTATCGAGACCCTACAGCATTTGGCTCAGGAATCCATAAAATCCGAATTAAG
TGGACCAAGCTAACTTCGGATTACCTCAAGGAAGTGGATGTTTTTGTTTCCATGGGATAC
CACAAAAAAACCTATGGAGGCTACCAGGGTAGAGTGTTTCTGAAGGGAGGCAGTGATAGT
GATGCTTCTCTGGTCATCACAGACCTCACTCTGGAAGATTATGGGAGATATAAGTGTGAG
GTGATTGAAGGATTAGAAGATGATACTGTTGTGGTAGCACTGGACTTACAAGGTGTGGTA
TTCCCTTACTTTCCACGACTGGGGCGCTACAATCTCAATTTTCACGAGGCGCAGCAGGCG
TGTCTGGACCAGGATGCTGTGATCGCCTCCTTCGACCAGCTGTACGACGCCTGGCGGGGC
GGGCTGGACTGGTGCAATGCCGGCTGGCTCAGTGATGGCTCTGTGCAATATCCCATCACA
AAGCCCAGAGAGCCCTGTGGGGGGCAGAACACAGTGCCCGGAGTCAGGAACTACGGATTT
TGGGATAAAGATAAAAGCAGATATGATGTTTTCTGTTTTACATCCAATTTCAATGGCCGT
TTTTACTATCTGATCCACCCCACCAAACTGACCTATGATGAAGCGGTGCAAGCTTGTCTC
AATGATGGTGCTCAGATTGCAAAAGTGGGCCAGATATTTGCTGCCTGGAAAATTCTCGGA
TATGACCGCTGTGATGCGGGCTGGTTGGCGGATGGCAGCGTCCGCTACCCCATCTCTAGG
CCAAGAAGGCGCTGCAGTCCTACTGAGGCTGCAGTGCGCTTCGTGGGTTTCCCAGATAAA
AAGCATAAGCTGTATGGTGTCTACTGCTTCAGAGCATACAACTGA
Chromosome Location
5
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP10915
UniProtKB Entry NameHPLN1_HUMAN
HGNC IDHGNC:2380
General References
  1. Dudhia J, Hardingham TE: The primary structure of human cartilage link protein. Nucleic Acids Res. 1990 Mar 11;18(5):1292. [PubMed:2320422]
  2. Dudhia J, Hardingham TE: The primary structure of human cartilage link protein. Nucleic Acids Res. 1990 Apr 25;18(8):2214. [PubMed:2336413]
  3. Osborne-Lawrence SL, Sinclair AK, Hicks RC, Lacey SW, Eddy RL Jr, Byers MG, Shows TB, Duby AD: Complete amino acid sequence of human cartilage link protein (CRTL1) deduced from cDNA clones and chromosomal assignment of the gene. Genomics. 1990 Nov;8(3):562-7. [PubMed:2286376]
  4. Rhodes C, Savagner P, Line S, Sasaki M, Chirigos M, Doege K, Yamada Y: Characterization of the promoter for the rat and human link protein gene. Nucleic Acids Res. 1991 Apr 25;19(8):1933-9. [PubMed:2030970]
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Hirakawa S, Oohashi T, Su WD, Yoshioka H, Murakami T, Arata J, Ninomiya Y: The brain link protein-1 (BRAL1): cDNA cloning, genomic structure, and characterization as a novel link protein expressed in adult brain. Biochem Biophys Res Commun. 2000 Oct 5;276(3):982-9. [PubMed:11027579]
  8. Spicer AP, Joo A, Bowling RA Jr: A hyaluronan binding link protein gene family whose members are physically linked adjacent to chondroitin sulfate proteoglycan core protein genes: the missing links. J Biol Chem. 2003 Jun 6;278(23):21083-91. Epub 2003 Mar 27. [PubMed:12663660]
  9. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08818Hyaluronic acidapproved, vet_approvedunknownbinderDetails