Islet amyloid polypeptide

Details

Name
Islet amyloid polypeptide
Synonyms
  • Amylin
  • DAP
  • Diabetes-associated peptide
  • Insulinoma amyloid peptide
Gene Name
IAPP
Organism
Humans
Amino acid sequence
>lcl|BSEQ0016252|Islet amyloid polypeptide
MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL
SSTNVGSNTYGKRNAVEVLKREPLNYLPL
Number of residues
89
Molecular Weight
9806.35
Theoretical pI
10.39
GO Classification
Functions
identical protein binding / receptor binding
Processes
apoptotic process / cell-cell signaling / cellular protein metabolic process / eating behavior / endocrine pancreas development / negative regulation of bone resorption / negative regulation of cell differentiation / sensory perception of pain / signal transduction
Components
extracellular region / extracellular space / neuronal cell body
General Function
Receptor binding
Specific Function
Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0016253|Islet amyloid polypeptide (IAPP)
ATGGGCATCCTGAAGCTGCAAGTATTTCTCATTGTGCTCTCTGTTGCATTGAACCATCTG
AAAGCTACACCCATTGAAAGTCATCAGGTGGAAAAGCGGAAATGCAACACTGCCACATGT
GCAACGCAGCGCCTGGCAAATTTTTTAGTTCATTCCAGCAACAACTTTGGTGCCATTCTC
TCATCTACCAACGTGGGATCCAATACATATGGCAAGAGGAATGCAGTAGAGGTTTTAAAG
AGAGAGCCACTGAATTACTTGCCCCTTTAG
Chromosome Location
12
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP10997
UniProtKB Entry NameIAPP_HUMAN
GenBank Protein ID457131
GenBank Gene IDM27503
GenAtlas IDIAPP
HGNC IDHGNC:5329
General References
  1. Mosselman S, Hoppener JW, Lips CJ, Jansz HS: The complete islet amyloid polypeptide precursor is encoded by two exons. FEBS Lett. 1989 Apr 10;247(1):154-8. [Article]
  2. Nishi M, Sanke T, Seino S, Eddy RL, Fan YS, Byers MG, Shows TB, Bell GI, Steiner DF: Human islet amyloid polypeptide gene: complete nucleotide sequence, chromosomal localization, and evolutionary history. Mol Endocrinol. 1989 Nov;3(11):1775-81. [Article]
  3. Sanke T, Bell GI, Sample C, Rubenstein AH, Steiner DF: An islet amyloid peptide is derived from an 89-amino acid precursor by proteolytic processing. J Biol Chem. 1988 Nov 25;263(33):17243-6. [Article]
  4. Christmanson L, Rorsman F, Stenman G, Westermark P, Betsholtz C: The human islet amyloid polypeptide (IAPP) gene. Organization, chromosomal localization and functional identification of a promoter region. FEBS Lett. 1990 Jul 2;267(1):160-6. [Article]
  5. van Mansfeld AD, Mosselman S, Hoppener JW, Zandberg J, van Teeffelen HA, Baas PD, Lips CJ, Jansz HS: Islet amyloid polypeptide: structure and upstream sequences of the IAPP gene in rat and man. Biochim Biophys Acta. 1990 Oct 23;1087(2):235-40. [Article]
  6. Hoppener JW, Oosterwijk C, Visser-Vernooy HJ, Lips CJ, Jansz HS: Characterization of the human islet amyloid polypeptide/amylin gene transcripts: identification of a new polyadenylation site. Biochem Biophys Res Commun. 1992 Dec 30;189(3):1569-77. [Article]
  7. Bhattacharya S, Latha JN, Kumresan R, Singh S: Cloning and expression of human islet amyloid polypeptide in cultured cells. Biochem Biophys Res Commun. 2007 May 11;356(3):622-8. Epub 2007 Mar 12. [Article]
  8. Mosselman S, Hoppener JW, Zandberg J, van Mansfeld AD, Geurts van Kessel AH, Lips CJ, Jansz HS: Islet amyloid polypeptide: identification and chromosomal localization of the human gene. FEBS Lett. 1988 Nov 7;239(2):227-32. [Article]
  9. Cooper GJ, Willis AC, Clark A, Turner RC, Sim RB, Reid KB: Purification and characterization of a peptide from amyloid-rich pancreases of type 2 diabetic patients. Proc Natl Acad Sci U S A. 1987 Dec;84(23):8628-32. [Article]
  10. Betsholtz C, Christmansson L, Engstrom U, Rorsman F, Svensson V, Johnson KH, Westermark P: Sequence divergence in a specific region of islet amyloid polypeptide (IAPP) explains differences in islet amyloid formation between species. FEBS Lett. 1989 Jul 17;251(1-2):261-4. [Article]
  11. Nakazato M, Asai J, Miyazato M, Matsukura S, Kangawa K, Matsuo H: Isolation and identification of islet amyloid polypeptide in normal human pancreas. Regul Pept. 1990 Dec 10;31(3):179-86. [Article]
  12. Westermark P, Wernstedt C, Wilander E, Sletten K: A novel peptide in the calcitonin gene related peptide family as an amyloid fibril protein in the endocrine pancreas. Biochem Biophys Res Commun. 1986 Nov 14;140(3):827-31. [Article]
  13. Westermark P, Wernstedt C, Wilander E, Hayden DW, O'Brien TD, Johnson KH: Amyloid fibrils in human insulinoma and islets of Langerhans of the diabetic cat are derived from a neuropeptide-like protein also present in normal islet cells. Proc Natl Acad Sci U S A. 1987 Jun;84(11):3881-5. [Article]
  14. Roberts AN, Leighton B, Todd JA, Cockburn D, Schofield PN, Sutton R, Holt S, Boyd Y, Day AJ, Foot EA, et al.: Molecular and functional characterization of amylin, a peptide associated with type 2 diabetes mellitus. Proc Natl Acad Sci U S A. 1989 Dec;86(24):9662-6. [Article]
  15. Hubbard JA, Martin SR, Chaplin LC, Bose C, Kelly SM, Price NC: Solution structures of calcitonin-gene-related-peptide analogues of calcitonin-gene-related peptide and amylin. Biochem J. 1991 May 1;275 ( Pt 3):785-8. [Article]
  16. Mascioni A, Porcelli F, Ilangovan U, Ramamoorthy A, Veglia G: Conformational preferences of the amylin nucleation site in SDS micelles: an NMR study. Biopolymers. 2003 May;69(1):29-41. [Article]
  17. Shen Y, Joachimiak A, Rosner MR, Tang WJ: Structures of human insulin-degrading enzyme reveal a new substrate recognition mechanism. Nature. 2006 Oct 19;443(7113):870-4. Epub 2006 Oct 11. [Article]
  18. Patil SM, Xu S, Sheftic SR, Alexandrescu AT: Dynamic alpha-helix structure of micelle-bound human amylin. J Biol Chem. 2009 May 1;284(18):11982-91. doi: 10.1074/jbc.M809085200. Epub 2009 Feb 24. [Article]
  19. Wiltzius JJ, Sievers SA, Sawaya MR, Eisenberg D: Atomic structures of IAPP (amylin) fusions suggest a mechanism for fibrillation and the role of insulin in the process. Protein Sci. 2009 Jul;18(7):1521-30. doi: 10.1002/pro.145. [Article]
  20. Sakagashira S, Sanke T, Hanabusa T, Shimomura H, Ohagi S, Kumagaye KY, Nakajima K, Nanjo K: Missense mutation of amylin gene (S20G) in Japanese NIDDM patients. Diabetes. 1996 Sep;45(9):1279-81. [Article]
  21. Chuang LM, Lee KC, Huang CN, Wu HP, Tai TY, Lin BJ: Role of S20G mutation of amylin gene in insulin secretion, insulin sensitivity, and type II diabetes mellitus in Taiwanese patients. Diabetologia. 1998 Oct;41(10):1250-1. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09130Copperapproved, investigationalunknownDetails