Solute carrier family 2, facilitated glucose transporter member 2

Details

Name
Solute carrier family 2, facilitated glucose transporter member 2
Synonyms
  • Glucose transporter type 2, liver
  • GLUT-2
  • GLUT2
Gene Name
SLC2A2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0002081|Solute carrier family 2, facilitated glucose transporter member 2
MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYV
INSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGD
TLGRIKAMLVANILSLVGALLMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIA
PTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLWHILLGLSGVRAILQSLLLFFCP
ESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSY
RQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNMVFTAVSVFLV
EKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFFEIGPGPIPW
FMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLLAFTLFT
FFKVPETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV
Number of residues
524
Molecular Weight
57488.955
Theoretical pI
8.1
GO Classification
Functions
D-glucose transmembrane transporter activity / dehydroascorbic acid transporter activity / glucose transmembrane transporter activity / hexose transmembrane transporter activity
Processes
carbohydrate metabolic process / carbohydrate utilization / endocrine pancreas development / energy reserve metabolic process / fructose transport / glucose transmembrane transport / glucose transport / hexose transmembrane transport / hexose transport / regulation of insulin secretion / response to glucose / response to peptide hormone / small molecule metabolic process / transmembrane transport
Components
basolateral plasma membrane / brush border membrane / cell-cell junction / cytosol / endosome / integral component of plasma membrane / membrane / plasma membrane
General Function
Hexose transmembrane transporter activity
Specific Function
Facilitative glucose transporter. This isoform likely mediates the bidirectional transfer of glucose across the plasma membrane of hepatocytes and is responsible for uptake of glucose by the beta cells; may comprise part of the glucose-sensing mechanism of the beta cell. May also participate with the Na(+)/glucose cotransporter in the transcellular transport of glucose in the small intestine and kidney.
Pfam Domain Function
Transmembrane Regions
11-31 99-119 128-148 159-179 188-208 218-238 304-324 339-359 369-389 401-421 434-454 462-482
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0020501|Solute carrier family 2, facilitated glucose transporter member 2 (SLC2A2)
ATGACAGAAGATAAGGTCACTGGGACCCTGGTTTTCACTGTCATCACTGCTGTGCTGGGT
TCCTTCCAGTTTGGATATGACATTGGTGTGATCAATGCACCTCAACAGGTAATAATATCT
CACTATAGACATGTTTTGGGTGTTCCACTGGATGACCGAAAAGCTATCAACAACTATGTT
ATCAACAGTACAGATGAACTGCCCACAATCTCATACTCAATGAACCCAAAACCAACCCCT
TGGGCTGAGGAAGAGACTGTGGCAGCTGCTCAACTAATCACCATGCTCTGGTCCCTGTCT
GTATCCAGCTTTGCAGTTGGTGGAATGACTGCATCATTCTTTGGTGGGTGGCTTGGGGAC
ACACTTGGAAGAATCAAAGCCATGTTAGTAGCAAACATTCTGTCATTAGTTGGAGCTCTC
TTGATGGGGTTTTCAAAATTGGGACCATCTCATATACTTATAATTGCTGGAAGAAGCATA
TCAGGACTATATTGTGGGCTAATTTCAGGCCTGGTTCCTATGTATATCGGTGAAATTGCT
CCAACCGCTCTCAGGGGAGCACTTGGCACTTTTCATCAGCTGGCCATCGTCACGGGCATT
CTTATTAGTCAGATTATTGGTCTTGAATTTATCTTGGGCAATTATGATCTGTGGCACATC
CTGCTTGGCCTGTCTGGTGTGCGAGCCATCCTTCAGTCTCTGCTACTCTTTTTCTGTCCA
GAAAGCCCCAGATACCTTTACATCAAGTTAGATGAGGAAGTCAAAGCAAAACAAAGCTTG
AAAAGACTCAGAGGATATGATGATGTCACCAAAGATATTAATGAAATGAGAAAAGAAAGA
GAAGAAGCATCGAGTGAGCAGAAAGTCTCTATAATTCAGCTCTTCACCAATTCCAGCTAC
CGACAGCCTATTCTAGTGGCACTGATGCTGCATGTGGCTCAGCAATTTTCCGGAATCAAT
GGCATTTTTTACTACTCAACCAGCATTTTTCAGACGGCTGGTATCAGCAAACCTGTTTAT
GCAACCATTGGAGTTGGCGCTGTAAACATGGTTTTCACTGCTGTCTCTGTATTCCTTGTG
GAGAAGGCAGGGCGACGTTCTCTCTTTCTAATTGGAATGAGTGGGATGTTTGTTTGTGCC
ATCTTCATGTCAGTGGGACTTGTGCTGCTGAATAAGTTCTCTTGGATGAGTTATGTGAGC
ATGATAGCCATCTTCCTCTTTGTCAGCTTCTTTGAAATTGGGCCAGGCCCGATCCCCTGG
TTCATGGTGGCTGAGTTTTTCAGTCAAGGACCACGTCCTGCTGCTTTAGCAATAGCTGCA
TTCAGCAATTGGACCTGCAATTTCATTGTAGCTCTGTGTTTCCAGTACATTGCGGACTTC
TGTGGACCTTATGTGTTTTTCCTCTTTGCTGGAGTGCTCCTGGCCTTTACCCTGTTCACA
TTTTTTAAAGTTCCAGAAACCAAAGGAAAGTCTTTTGAGGAAATTGCTGCAGAATTCCAA
AAGAAGAGTGGCTCAGCCCACAGGCCAAAAGCTGCTGTAGAAATGAAATTCCTAGGAGCT
ACAGAGACTGTGTAA
Chromosome Location
3
Locus
3q26.1-q26.2
External Identifiers
ResourceLink
UniProtKB IDP11168
UniProtKB Entry NameGTR2_HUMAN
GenBank Protein ID307125
GenBank Gene IDJ03810
GenAtlas IDSLC2A2
HGNC IDHGNC:11006
General References
  1. Fukumoto H, Seino S, Imura H, Seino Y, Eddy RL, Fukushima Y, Byers MG, Shows TB, Bell GI: Sequence, tissue distribution, and chromosomal localization of mRNA encoding a human glucose transporter-like protein. Proc Natl Acad Sci U S A. 1988 Aug;85(15):5434-8. [PubMed:3399500]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997]
  4. Matsubara A, Tanizawa Y, Matsutani A, Kaneko T, Kaku K: Sequence variations of the pancreatic islet/liver glucose transporter (GLUT2) gene in Japanese subjects with noninsulin dependent diabetes mellitus. J Clin Endocrinol Metab. 1995 Nov;80(11):3131-5. [PubMed:7593414]
  5. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  6. Tanizawa Y, Riggs AC, Chiu KC, Janssen RC, Bell DS, Go RP, Roseman JM, Acton RT, Permutt MA: Variability of the pancreatic islet beta cell/liver (GLUT 2) glucose transporter gene in NIDDM patients. Diabetologia. 1994 Apr;37(4):420-7. [PubMed:8063045]
  7. Mueckler M, Kruse M, Strube M, Riggs AC, Chiu KC, Permutt MA: A mutation in the Glut2 glucose transporter gene of a diabetic patient abolishes transport activity. J Biol Chem. 1994 Jul 8;269(27):17765-7. [PubMed:8027028]
  8. Burwinkel B, Sanjad SA, Al-Sabban E, Al-Abbad A, Kilimann MW: A mutation in GLUT2, not in phosphorylase kinase subunits, in hepato-renal glycogenosis with Fanconi syndrome and low phosphorylase kinase activity. Hum Genet. 1999 Sep;105(3):240-3. [PubMed:10987651]
  9. Sakamoto O, Ogawa E, Ohura T, Igarashi Y, Matsubara Y, Narisawa K, Iinuma K: Mutation analysis of the GLUT2 gene in patients with Fanconi-Bickel syndrome. Pediatr Res. 2000 Nov;48(5):586-9. [PubMed:11044475]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00428Streptozocinapproved, investigationalunknownligandDetails
DB09502Fludeoxyglucose (18F)approved, investigationalyessubstrateDetails
DB09341Dextrose, unspecified formapproved, vet_approvedunknownsubstrateDetails
DB09344Invert sugarexperimentalnosubstrateDetails
DB01914D-glucoseapproved, investigational, vet_approvednosubstrateDetails