Muscarinic acetylcholine receptor M1

Details

Name
Muscarinic acetylcholine receptor M1
Synonyms
Not Available
Gene Name
CHRM1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0000184|Muscarinic acetylcholine receptor M1
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Number of residues
460
Molecular Weight
51420.375
Theoretical pI
9.67
GO Classification
Functions
drug binding / G-protein coupled acetylcholine receptor activity / phosphatidylinositol phospholipase C activity
Processes
adenylate cyclase-inhibiting G-protein coupled acetylcholine receptor signaling pathway / cell proliferation / cellular protein modification process / cognition / entrainment of circadian clock / G-protein coupled acetylcholine receptor signaling pathway / G-protein coupled receptor signaling pathway / nervous system development / neuromuscular synaptic transmission / phospholipase C-activating G-protein coupled acetylcholine receptor signaling pathway / phototransduction, visible light / positive regulation of cell proliferation / positive regulation of intracellular protein transport / positive regulation of ion transport / protein kinase C-activating G-protein coupled receptor signaling pathway / regulation of locomotion / saliva secretion / sensory perception of chemical stimulus / signal transduction / synaptic transmission, cholinergic
Components
asymmetric synapse / axon terminus / cell junction / dendrite / integral component of plasma membrane / membrane / plasma membrane / postsynaptic density / postsynaptic membrane / synapse
General Function
Phosphatidylinositol phospholipase c activity
Specific Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Pfam Domain Function
Transmembrane Regions
25-47 62-82 100-121 142-164 187-209 367-387 402-421
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0009929|Muscarinic acetylcholine receptor M1 (CHRM1)
ATGAACACTTCAGCCCCACCTGCTGTCAGCCCCAACATCACCGTCCTGGCACCAGGAAAG
GGTCCCTGGCAAGTGGCCTTCATTGGGATCACCACGGGCCTCCTGTCGCTAGCCACAGTG
ACAGGCAACCTGCTGGTACTCATCTCTTTCAAGGTCAACACGGAGCTCAAGACAGTCAAT
AACTACTTCCTGCTGAGCCTGGCCTGTGCTGACCTCATCATCGGTACCTTCTCCATGAAC
CTCTATACCACGTACCTGCTCATGGGCCACTGGGCTCTGGGCACGCTGGCTTGTGACCTC
TGGCTGGCCCTGGACTATGTGGCCAGCAATGCCTCCGTCATGAATCTGCTGCTCATCAGC
TTTGACCGCTACTTCTCCGTGACTCGGCCCCTGAGCTACCGTGCCAAGCGCACACCCCGC
CGGGCAGCTCTGATGATCGGCCTGGCCTGGCTGGTTTCCTTTGTGCTCTGGGCCCCAGCC
ATCCTCTTCTGGCAGTACCTGGTAGGGGAGCGGACAGTGCTAGCTGGGCAGTGCTACATC
CAGTTCCTCTCCCAGCCCATCATCACCTTTGGCACAGCCATGGCTGCCTTCTACCTCCCT
GTCACAGTCATGTGCACGCTCTACTGGCGCATCTACCGGGAGACAGAGAACCGAGCACGG
GAGCTGGCAGCCCTTCAGGGCTCCGAGACGCCAGGCAAAGGGGGTGGCAGCAGCAGCAGC
TCAGAGAGGTCTCAGCCAGGGGCTGAGGGCTCACCAGAGACTCCTCCAGGCCGCTGCTGT
CGCTGCTGCCGGGCCCCCAGGCTGCTGCAGGCCTACAGCTGGAAGGAAGAAGAGGAAGAG
GACGAAGGCTCCATGGAGTCCCTCACATCCTCAGAGGGAGAGGAGCCTGGCTCCGAAGTG
GTGATCAAGATGCCAATGGTGGACCCCGAGGCACAGGCCCCCACCAAGCAGCCCCCACGG
AGCTCCCCAAATACAGTCAAGAGGCCGACTAAGAAAGGGCGTGATCGAGCTGGCAAGGGC
CAGAAGCCCCGTGGAAAGGAGCAGCTGGCCAAGCGGAAGACCTTCTCGCTGGTCAAGGAG
AAGAAGGCGGCTCGGACCCTGAGTGCCATCCTCCTGGCCTTCATCCTCACCTGGACACCG
TACAACATCATGGTGCTGGTGTCCACCTTCTGCAAGGACTGTGTTCCCGAGACCCTGTGG
GAGCTGGGCTACTGGCTGTGCTACGTCAACAGCACCATCAACCCCATGTGCTACGCACTC
TGCAACAAAGCCTTCCGGGACACCTTTCGCCTGCTGCTGCTTTGCCGCTGGGACAAGAGA
CGCTGGCGCAAGATCCCCAAGCGCCCTGGCTCCGTGCACCGCACTCCCTCCCGCCAATGC
TGA
Chromosome Location
11
Locus
11q13
External Identifiers
ResourceLink
UniProtKB IDP11229
UniProtKB Entry NameACM1_HUMAN
GenBank Protein ID34451
GenBank Gene IDX52068
GenAtlas IDCHRM1
HGNC IDHGNC:1950
General References
  1. Allard WJ, Sigal IS, Dixon RA: Sequence of the gene encoding the human M1 muscarinic acetylcholine receptor. Nucleic Acids Res. 1987 Dec 23;15(24):10604. [PubMed:3697105]
  2. Chapman CG, Browne MJ: Isolation of the human ml (Hml) muscarinic acetylcholine receptor gene by PCR amplification. Nucleic Acids Res. 1990 Apr 25;18(8):2191. [PubMed:2336407]
  3. Peralta EG, Ashkenazi A, Winslow JW, Smith DH, Ramachandran J, Capon DJ: Distinct primary structures, ligand-binding properties and tissue-specific expression of four human muscarinic acetylcholine receptors. EMBO J. 1987 Dec 20;6(13):3923-9. [PubMed:3443095]
  4. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Arden JR, Nagata O, Shockley MS, Philip M, Lameh J, Sadee W: Mutational analysis of third cytoplasmic loop domains in G-protein coupling of the HM1 muscarinic receptor. Biochem Biophys Res Commun. 1992 Nov 16;188(3):1111-5. [PubMed:1445347]
  7. Simonin F, Karcher P, Boeuf JJ, Matifas A, Kieffer BL: Identification of a novel family of G protein-coupled receptor associated sorting proteins. J Neurochem. 2004 May;89(3):766-75. [PubMed:15086532]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00185CevimelineapprovedyesagonistDetails
DB00202SuccinylcholineapprovedyesagonistDetails
DB00209TrospiumapprovedunknownantagonistDetails
DB00219OxyphenoniumapprovedyesantagonistDetails
DB00245BenzatropineapprovedyesantagonistDetails
DB00332IpratropiumapprovedyesantagonistDetails
DB00376TrihexyphenidylapprovedyesantagonistDetails
DB00383OxyphencyclimineapprovedyesantagonistDetails
DB00387ProcyclidineapprovedyesantagonistDetails
DB00411CarbamoylcholineapprovedyesagonistDetails
DB00424HyoscyamineapprovedyesantagonistDetails
DB00462Methscopolamine bromideapprovedyesantagonistDetails
DB00505TridihexethylwithdrawnyesantagonistDetails
DB00517Anisotropine methylbromideapprovedyesantagonistDetails
DB00670PirenzepineapprovedyesantagonistDetails
DB00747Scopolamineapproved, investigationalyesantagonistDetails
DB00771ClidiniumapprovedyesantagonistDetails
DB00782PropanthelineapprovedyesantagonistDetails
DB00804DicyclomineapprovedyesantagonistDetails
DB00940Methanthelineapproved, investigationalunknownantagonistDetails
DB00942CycrimineapprovedyesantagonistDetails
DB00979CyclopentolateapprovedyesantagonistDetails
DB00986Glycopyrroniumapproved, investigational, vet_approvedyesantagonistDetails
DB01036Tolterodineapproved, investigationalyesantagonistDetails
DB01062Oxybutyninapproved, investigationalyesantagonistDetails
DB01085Pilocarpineapproved, investigationalyesagonistDetails
DB01148FlavoxateapprovedyesantagonistDetails
DB01151Desipramineapproved, investigationalnoantagonistDetails
DB01233Metoclopramideapproved, investigationalyesagonistDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB00340MetixeneapprovedyesantagonistDetails
DB00354BuclizineapprovedyesantagonistDetails
DB00366Doxylamineapproved, vet_approvedunknownantagonistDetails
DB00392ProfenamineapprovedyesantagonistDetails
DB00420Promazineapproved, vet_approvedunknownantagonistDetails
DB00508Triflupromazineapproved, vet_approvedyesantagonistDetails
DB00572Atropineapproved, vet_approvedyesantagonistDetails
DB00725Homatropine MethylbromideapprovedyesantagonistDetails
DB00767BenzquinamidewithdrawnyesantagonistDetails
DB00777PropiomazineapprovedunknownantagonistDetails
DB00785CryptenamineapprovedyesantagonistDetails
DB00810Biperidenapproved, investigationalyesantagonistDetails
DB01069Promethazineapproved, investigationalunknownantagonistDetails
DB01231Diphenidolapproved, investigational, withdrawnyesantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB04365ArecolineexperimentalunknownDetails
DB01591SolifenacinapprovedunknownantagonistDetails
DB05152NGX267investigationalunknownDetails
DB05752ALKS 27investigationalunknownDetails
DB05766ACP-104investigationalunknownDetails
DB00622Nicardipineapproved, investigationalunknownantagonistDetails
DB06702FesoterodineapprovedunknownantagonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB01409TiotropiumapprovedunknownantagonistDetails
DB00246ZiprasidoneapprovednoantagonistDetails
DB00363ClozapineapprovednoantagonistDetails
DB01238Aripiprazoleapproved, investigationalnoantagonistDetails
DB00496Darifenacinapproved, investigationalunknownantagonistDetails
DB01618Molindoneapprovedunknownother/unknownDetails
DB00907Cocaineapproved, illicitunknownantagonistDetails
DB00280DisopyramideapprovedunknownantagonistDetails
DB01239Chlorprothixeneexperimental, investigational, withdrawnnoantagonistDetails
DB01142Doxepinapproved, investigationalyesantagonistDetails
DB00321AmitriptylineapprovednoantagonistDetails
DB00458ImipramineapprovednoantagonistDetails
DB00540NortriptylineapprovednoantagonistDetails
DB00715Paroxetineapproved, investigationalnoantagonistDetails
DB00434CyproheptadineapprovedunknownantagonistDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB01175Escitalopramapproved, investigationalunknownantagonistDetails
DB00835BrompheniramineapprovedunknownantagonistDetails
DB00809Tropicamideapproved, investigationalunknownantagonistDetails
DB00934Maprotilineapproved, investigationalnoantagonistDetails
DB00875Flupentixolapproved, investigational, withdrawnunknownantagonistDetails
DB00805MinaprineapprovedunknownagonistDetails
DB04843MepenzolateapprovedyesantagonistDetails
DB08897AclidiniumapprovedyesantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknownantagonistDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00342Terfenadineapproved, withdrawnunknownbinderDetails
DB09076UmeclidiniumapprovednoantagonistDetails
DB06787HexocycliumapprovedunknownantagonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB09262ImidafenacininvestigationalyesantagonistDetails
DB03128Acetylcholineapproved, investigationalunknownDetails
DB00483Gallamine TriethiodideapprovedunknownDetails
DB02010StaurosporineexperimentalunknownDetails
DB01019BethanecholapprovedunknownDetails
DB11156Pyrantelapproved, vet_approvednoantagonistagonistDetails
DB11181HomatropineapprovedyesantagonistDetails
DB06153PizotifenapprovedunknownantagonistDetails
DB12278Propiverineapproved, investigationalyesantagonistDetails
DB11235ThonzylamineapprovedunknownantagonistDetails
DB00193Tramadolapproved, investigationalunknownantagonistDetails
DB09089TrimebutineapprovedyesantagonistDetails
DB14185Aripiprazole lauroxilapproved, investigationalnoDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00726TrimipramineapprovedunknownbinderDetails
DB00454MeperidineapprovedunknownbinderDetails
DB00568Cinnarizineapproved, investigationalunknownbinderDetails
DB01221Ketamineapproved, vet_approvedunknownbinderDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB11855Revefenacinapproved, investigationalyesantagonistDetails