Cation-independent mannose-6-phosphate receptor

Details

Name
Cation-independent mannose-6-phosphate receptor
Synonyms
  • 300 kDa mannose 6-phosphate receptor
  • CI Man-6-P receptor
  • IGF-II receptor
  • Insulin-like growth factor 2 receptor
  • Insulin-like growth factor II receptor
  • M6P/IGF2 receptor
  • M6P/IGF2R
  • MPR 300
  • MPRI
Gene Name
IGF2R
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012517|Cation-independent mannose-6-phosphate receptor
MGAAAGRSPHLGPAPARRPQRSLLLLQLLLLVAAPGSTQAQAAPFPELCSYTWEAVDTKN
NVLYKINICGSVDIVQCGPSSAVCMHDLKTRTYHSVGDSVLRSATRSLLEFNTTVSCDQQ
GTNHRVQSSIAFLCGKTLGTPEFVTATECVHYFEWRTTAACKKDIFKANKEVPCYVFDEE
LRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGH
QAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSERREGTIPKL
TAKSNCRYEIEWITEYACHRDYLESKTCSLSGEQQDVSIDLTPLAQSGGSSYISDGKEYL
FYLNVCGETEIQFCNKKQAAVCQVKKSDTSQVKAAGRYHNQTLRYSDGDLTLIYFGGDEC
SSGFQRMSVINFECNKTAGNDGKGTPVFTGEVDCTYFFTWDTEYACVKEKEDLLCGATDG
KKRYDLSALVRHAEPEQNWEAVDGSQTETEKKHFFINICHRVLQEGKARGCPEDAAVCAV
DKNGSKNLGKFISSPMKEKGNIQLSYSDGDDCGHGKKIKTNITLVCKPGDLESAPVLRTS
GEGGCFYEFEWHTAAACVLSKTEGENCTVFDSQAGFSFDLSPLTKKNGAYKVETKKYDFY
INVCGPVSVSPCQPDSGACQVAKSDEKTWNLGLSNAKLSYYDGMIQLNYRGGTPYNNERH
TPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECVVTDPSTLEQYDL
SSLAKSEGGLGGNWYAMDNSGEHVTWRKYYINVCRPLNPVPGCNRYASACQMKYEKDQGS
FTEVVSISNLGMAKTGPVVEDSGSLLLEYVNGSACTTSDGRQTTYTTRIHLVCSRGRLNS
HPIFSLNWECVVSFLWNTEAACPIQTTTDTDQACSIRDPNSGFVFNLNPLNSSQGYNVSG
IGKIFMFNVCGTMPVCGTILGKPASGCEAETQTEELKNWKPARPVGIEKSLQLSTEGFIT
LTYKGPLSAKGTADAFIVRFVCNDDVYSGPLKFLHQDIDSGQGIRNTYFEFETALACVPS
PVDCQVTDLAGNEYDLTGLSTVRKPWTAVDTSVDGRKRTFYLSVCNPLPYIPGCQGSAVG
SCLVSEGNSWNLGVVQMSPQAAANGSLSIMYVNGDKCGNQRFSTRITFECAQISGSPAFQ
LQDGCEYVFIWRTVEACPVVRVEGDNCEVKDPRHGNLYDLKPLGLNDTIVSAGEYTYYFR
VCGKLSSDVCPTSDKSKVVSSCQEKREPQGFHKVAGLLTQKLTYENGLLKMNFTGGDTCH
KVYQRSTAIFFYCDRGTQRPVFLKETSDCSYLFEWRTQYACPPFDLTECSFKDGAGNSFD
LSSLSRYSDNWEAITGTGDPEHYLINVCKSLAPQAGTEPCPPEAAACLLGGSKPVNLGRV
RDGPQWRDGIIVLKYVDGDLCPDGIRKKSTTIRFTCSESQVNSRPMFISAVEDCEYTFAW
PTATACPMKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCP
PGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEARP
TNRPMLISLDKQTCTLFFSWHTPLACEQATECSVRNGSSIVDLSPLIHRTGGYEAYDESE
DDASDTNPDFYINICQPLNPMHGVPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPIANEI
YLNFESSTPCLADKHFNYTSLIAFHCKRGVSMGTPKLLRTSECDFVFEWETPVVCPDEVR
MDGCTLTDEQLLYSFNLSSLSTSTFKVTRDSRTYSVGVCTFAVGPEQGGCKDGGVCLLSG
TKGASFGRLQSMKLDYRHQDEAVVLSYVNGDRCPPETDDGVPCVFPFIFNGKSYEECIIE
SRAKLWCSTTADYDRDHEWGFCRHSNSYRTSSIIFKCDEDEDIGRPQVFSEVRGCDVTFE
WKTKVVCPPKKLECKFVQKHKTYDLRLLSSLTGSWSLVHNGVSYYINLCQKIYKGPLGCS
ERASICRRTTTGDVQVLGLVHTQKLGVIGDKVVVTYSKGYPCGGNKTASSVIELTCTKTV
GRPAFKRFDIDSCTYYFSWDSRAACAVKPQEVQMVNGTITNPINGKSFSLGDIYFKLFRA
SGDMRTNGDNYLYEIQLSSITSSRNPACSGANICQVKPNDQHFSRKVGTSDKTKYYLQDG
DLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVEDGIPEFSHETADCQYLFSWYTSAVCPL
GVGFDSENPGDDGQMHKGLSERSQAVGAVLSLLLVALTCCLLALLLYKKERRETVISKLT
TCCRRSSNVSYKYSKVNKEEETDENETEWLMEEIQLPPPRQGKEGQENGHITTKSVKALS
SLHGDDQDSEDEVLTIPEVKVHSGRGAGAESSHPVRNAQSNALQEREDDRVGLVRGEKAR
KGKSSSAQQKTVSSTKLVSFHDDSDEDLLHI
Number of residues
2491
Molecular Weight
274372.42
Theoretical pI
5.71
GO Classification
Functions
glycoprotein binding / identical protein binding / insulin-like growth factor-activated receptor activity / mannose binding / phosphoprotein binding / receptor activity / transporter activity
Processes
insulin-like growth factor receptor signaling pathway / receptor-mediated endocytosis / signal transduction
Components
cell surface / early endosome / endocytic vesicle / endosome / extracellular exosome / focal adhesion / integral component of plasma membrane / late endosome / lysosomal membrane / membrane / nuclear envelope lumen / trans-Golgi network / trans-Golgi network transport vesicle
General Function
Transporter activity
Specific Function
Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. This receptor also binds IGF2. Acts as a positive regulator of T-cell coactivation, by binding DPP4.
Pfam Domain Function
Transmembrane Regions
2305-2327
Cellular Location
Lysosome membrane
Gene sequence
>lcl|BSEQ0012518|Cation-independent mannose-6-phosphate receptor (IGF2R)
ATGGGGGCCGCCGCCGGCCGGAGCCCCCACCTGGGGCCCGCGCCCGCCCGCCGCCCGCAG
CGCTCTCTGCTCCTGCTGCAGCTGCTGCTGCTCGTCGCTGCCCCGGGGTCCACGCAGGCC
CAGGCCGCCCCGTTCCCCGAGCTGTGCAGTTATACATGGGAAGCTGTTGATACCAAAAAT
AATGTACTTTATAAAATCAACATCTGTGGAAGTGTGGATATTGTCCAGTGCGGGCCATCA
AGTGCTGTTTGTATGCACGACTTGAAGACACGCACTTATCATTCAGTGGGTGACTCTGTT
TTGAGAAGTGCAACCAGATCTCTCCTGGAATTCAACACAACAGTGAGCTGTGACCAGCAA
GGCACAAATCACAGAGTCCAGAGCAGCATTGCCTTCCTGTGTGGGAAAACCCTGGGAACT
CCTGAATTTGTAACTGCAACAGAATGTGTGCACTACTTTGAGTGGAGGACCACTGCAGCC
TGCAAGAAAGACATATTTAAAGCAAATAAGGAGGTGCCATGCTATGTGTTTGATGAAGAG
TTGAGGAAGCATGATCTCAATCCTCTGATCAAGCTTAGTGGTGCCTACTTGGTGGATGAC
TCCGATCCGGACACTTCTCTATTCATCAATGTTTGTAGAGACATAGACACACTACGAGAC
CCAGGTTCACAGCTGCGGGCCTGTCCCCCCGGCACTGCCGCCTGCCTGGTAAGAGGACAC
CAGGCGTTTGATGTTGGCCAGCCCCGGGACGGACTGAAGCTGGTGCGCAAGGACAGGCTT
GTCCTGAGTTACGTGAGGGAAGAGGCAGGAAAGCTAGACTTTTGTGATGGTCACAGCCCT
GCGGTGACTATTACATTTGTTTGCCCGTCGGAGCGGAGAGAGGGCACCATTCCCAAACTC
ACAGCTAAATCCAACTGCCGCTATGAAATTGAGTGGATTACTGAGTATGCCTGCCACAGA
GATTACCTGGAAAGTAAAACTTGTTCTCTGAGCGGCGAGCAGCAGGATGTCTCCATAGAC
CTCACACCACTTGCCCAGAGCGGAGGTTCATCCTATATTTCAGATGGAAAAGAATATTTG
TTTTATTTGAATGTCTGTGGAGAAACTGAAATACAGTTCTGTAATAAAAAACAAGCTGCA
GTTTGCCAAGTGAAAAAGAGCGATACCTCTCAAGTCAAAGCAGCAGGAAGATACCACAAT
CAGACCCTCCGATATTCGGATGGAGACCTCACCTTGATATATTTTGGAGGTGATGAATGC
AGCTCAGGGTTTCAGCGGATGAGCGTCATAAACTTTGAGTGCAATAAAACCGCAGGTAAC
GATGGGAAAGGAACTCCTGTATTCACAGGGGAGGTTGACTGCACCTACTTCTTCACATGG
GACACGGAATACGCCTGTGTTAAGGAGAAGGAAGACCTCCTCTGCGGTGCCACCGACGGG
AAGAAGCGCTATGACCTGTCCGCGCTGGTCCGCCATGCAGAACCAGAGCAGAATTGGGAA
GCTGTGGATGGCAGTCAGACGGAAACAGAGAAGAAGCATTTTTTCATTAATATTTGTCAC
AGAGTGCTGCAGGAAGGCAAGGCACGAGGGTGTCCCGAGGACGCGGCAGTGTGTGCAGTG
GATAAAAATGGAAGTAAAAATCTGGGAAAATTTATTTCCTCTCCCATGAAAGAGAAAGGA
AACATTCAACTCTCTTATTCAGATGGTGATGATTGTGGTCATGGCAAGAAAATTAAAACT
AATATCACACTTGTATGCAAGCCAGGTGATCTGGAAAGTGCACCAGTGTTGAGAACTTCT
GGGGAAGGCGGTTGCTTTTATGAGTTTGAGTGGCACACAGCTGCGGCCTGTGTGCTGTCT
AAGACAGAAGGGGAGAACTGCACGGTCTTTGACTCCCAGGCAGGGTTTTCTTTTGACTTA
TCACCTCTCACAAAGAAAAATGGTGCCTATAAAGTTGAGACAAAGAAGTATGACTTTTAT
ATAAATGTGTGTGGCCCGGTGTCTGTGAGCCCCTGTCAGCCAGACTCAGGAGCCTGCCAG
GTGGCAAAAAGTGATGAGAAGACTTGGAACTTGGGTCTGAGTAATGCGAAGCTTTCATAT
TATGATGGGATGATCCAACTGAACTACAGAGGCGGCACACCCTATAACAATGAAAGACAC
ACACCGAGAGCTACGCTCATCACCTTTCTCTGTGATCGAGACGCGGGAGTGGGCTTCCCT
GAATATCAGGAAGAGGATAACTCCACCTACAACTTCCGGTGGTACACCAGCTATGCCTGC
CCGGAGGAGCCCCTGGAATGCGTAGTGACCGACCCCTCCACGCTGGAGCAGTACGACCTC
TCCAGTCTGGCAAAATCTGAAGGTGGCCTTGGAGGAAACTGGTATGCCATGGACAACTCA
GGGGAACATGTCACGTGGAGGAAATACTACATTAACGTGTGTCGGCCTCTGAATCCAGTG
CCGGGCTGCAACCGATATGCATCGGCTTGCCAGATGAAGTATGAAAAAGATCAGGGCTCC
TTCACTGAAGTGGTTTCCATCAGTAACTTGGGAATGGCAAAGACCGGCCCGGTGGTTGAG
GACAGCGGCAGCCTCCTTCTGGAATACGTGAATGGGTCGGCCTGCACCACCAGCGATGGC
AGACAGACCACATATACCACGAGGATCCATCTCGTCTGCTCCAGGGGCAGGCTGAACAGC
CACCCCATCTTTTCTCTCAACTGGGAGTGTGTGGTCAGTTTCCTGTGGAACACAGAGGCT
GCCTGTCCCATTCAGACAACGACGGATACAGACCAGGCTTGCTCTATAAGGGATCCCAAC
AGTGGATTTGTGTTTAATCTTAATCCGCTAAACAGTTCGCAAGGATATAACGTCTCTGGC
ATTGGGAAGATTTTTATGTTTAATGTCTGCGGCACAATGCCTGTCTGTGGGACCATCCTG
GGAAAACCTGCTTCTGGCTGTGAGGCAGAAACCCAAACTGAAGAGCTCAAGAATTGGAAG
CCAGCAAGGCCAGTCGGAATTGAGAAAAGCCTCCAGCTGTCCACAGAGGGCTTCATCACT
CTGACCTACAAAGGGCCTCTCTCTGCCAAAGGTACCGCTGATGCTTTTATCGTCCGCTTT
GTTTGCAATGATGATGTTTACTCAGGGCCCCTCAAATTCCTGCATCAAGATATCGACTCT
GGGCAAGGGATCCGAAACACTTACTTTGAGTTTGAAACCGCGTTGGCCTGTGTTCCTTCT
CCAGTGGACTGCCAAGTCACCGACCTGGCTGGAAATGAGTACGACCTGACTGGCCTAAGC
ACAGTCAGGAAACCTTGGACGGCTGTTGACACCTCTGTCGATGGGAGAAAGAGGACTTTC
TATTTGAGCGTTTGCAATCCTCTCCCTTACATTCCTGGATGCCAGGGCAGCGCAGTGGGG
TCTTGCTTAGTGTCAGAAGGCAATAGCTGGAATCTGGGTGTGGTGCAGATGAGTCCCCAA
GCCGCGGCGAATGGATCTTTGAGCATCATGTATGTCAACGGTGACAAGTGTGGGAACCAG
CGCTTCTCCACCAGGATCACGTTTGAGTGTGCTCAGATATCGGGCTCACCAGCATTTCAG
CTTCAGGATGGTTGTGAGTACGTGTTTATCTGGAGAACTGTGGAAGCCTGTCCCGTTGTC
AGAGTGGAAGGGGACAACTGTGAGGTGAAAGACCCAAGGCATGGCAACTTGTATGACCTG
AAGCCCCTGGGCCTCAACGACACCATCGTGAGCGCTGGCGAATACACTTATTACTTCCGG
GTCTGTGGGAAGCTTTCCTCAGACGTCTGCCCCACAAGTGACAAGTCCAAGGTGGTCTCC
TCATGTCAGGAAAAGCGGGAACCGCAGGGATTTCACAAAGTGGCAGGTCTCCTGACTCAG
AAGCTAACTTATGAAAATGGCTTGTTAAAAATGAACTTCACGGGGGGGGACACTTGCCAT
AAGGTTTATCAGCGCTCCACAGCCATCTTCTTCTACTGTGACCGCGGCACCCAGCGGCCA
GTATTTCTAAAGGAGACTTCAGATTGTTCCTACTTGTTTGAGTGGCGAACGCAGTATGCC
TGCCCACCTTTCGATCTGACTGAATGTTCATTCAAAGATGGGGCTGGCAACTCCTTCGAC
CTCTCGTCCCTGTCAAGGTACAGTGACAACTGGGAAGCCATCACTGGGACGGGGGACCCG
GAGCACTACCTCATCAATGTCTGCAAGTCTCTGGCCCCGCAGGCTGGCACTGAGCCGTGC
CCTCCAGAAGCAGCCGCGTGTCTGCTGGGTGGCTCCAAGCCCGTGAACCTCGGCAGGGTA
AGGGACGGACCTCAGTGGAGAGATGGCATAATTGTCCTGAAATACGTTGATGGCGACTTA
TGTCCAGATGGGATTCGGAAAAAGTCAACCACCATCCGATTCACCTGCAGCGAGAGCCAA
GTGAACTCCAGGCCCATGTTCATCAGCGCCGTGGAGGACTGTGAGTACACCTTTGCCTGG
CCCACAGCCACAGCCTGTCCCATGAAGAGCAACGAGCATGATGACTGCCAGGTCACCAAC
CCAAGCACAGGACACCTGTTTGATCTGAGCTCCTTAAGTGGCAGGGCGGGATTCACAGCT
GCTTACAGCGAGAAGGGGTTGGTTTACATGAGCATCTGTGGGGAGAATGAAAACTGCCCT
CCTGGCGTGGGGGCCTGCTTTGGACAGACCAGGATTAGCGTGGGCAAGGCCAACAAGAGG
CTGAGATACGTGGACCAGGTCCTGCAGCTGGTGTACAAGGATGGGTCCCCTTGTCCCTCC
AAATCCGGCCTGAGCTATAAGAGTGTGATCAGTTTCGTGTGCAGGCCTGAGGCCGGGCCA
ACCAATAGGCCCATGCTCATCTCCCTGGACAAGCAGACATGCACTCTCTTCTTCTCCTGG
CACACGCCGCTGGCCTGCGAGCAAGCGACCGAATGTTCCGTGAGGAATGGAAGCTCTATT
GTTGACTTGTCTCCCCTTATTCATCGCACTGGTGGTTATGAGGCTTATGATGAGAGTGAG
GATGATGCCTCCGATACCAACCCTGATTTCTACATCAATATTTGTCAGCCACTAAATCCC
ATGCACGGAGTGCCCTGTCCTGCCGGAGCCGCTGTGTGCAAAGTTCCTATTGATGGTCCC
CCCATAGATATCGGCCGGGTAGCAGGACCACCAATACTCAATCCAATAGCAAATGAGATT
TACTTGAATTTTGAAAGCAGTACTCCTTGCTTAGCGGACAAGCATTTCAACTACACCTCG
CTCATCGCGTTTCACTGTAAGAGAGGTGTGAGCATGGGAACGCCTAAGCTGTTAAGGACC
AGCGAGTGCGACTTTGTGTTCGAATGGGAGACTCCTGTCGTCTGTCCTGATGAAGTGAGG
ATGGATGGCTGTACCCTGACAGATGAGCAGCTCCTCTACAGCTTCAACTTGTCCAGCCTT
TCCACGAGCACCTTTAAGGTGACTCGCGACTCGCGCACCTACAGCGTTGGGGTGTGCACC
TTTGCAGTCGGGCCAGAACAAGGAGGCTGTAAGGACGGAGGAGTCTGTCTGCTCTCAGGC
ACCAAGGGGGCATCCTTTGGACGGCTGCAATCAATGAAACTGGATTACAGGCACCAGGAT
GAAGCGGTCGTTTTAAGTTACGTGAATGGTGATCGTTGCCCTCCAGAAACCGATGACGGC
GTCCCCTGTGTCTTCCCCTTCATATTCAATGGGAAGAGCTACGAGGAGTGCATCATAGAG
AGCAGGGCGAAGCTGTGGTGTAGCACAACTGCGGACTACGACAGAGACCACGAGTGGGGC
TTCTGCAGACACTCAAACAGCTACCGGACATCCAGCATCATATTTAAGTGTGATGAAGAT
GAGGACATTGGGAGGCCACAAGTCTTCAGTGAAGTGCGTGGGTGTGATGTGACATTTGAG
TGGAAAACAAAAGTTGTCTGCCCTCCAAAGAAGTTGGAGTGCAAATTCGTCCAGAAACAC
AAAACCTACGACCTGCGGCTGCTCTCCTCTCTCACCGGGTCCTGGTCCCTGGTCCACAAC
GGAGTCTCGTACTATATAAATCTGTGCCAGAAAATATATAAAGGGCCCCTGGGCTGCTCT
GAAAGGGCCAGCATTTGCAGAAGGACCACAACTGGTGACGTCCAGGTCCTGGGACTCGTT
CACACGCAGAAGCTGGGTGTCATAGGTGACAAAGTTGTTGTCACGTACTCCAAAGGTTAT
CCGTGTGGTGGAAATAAGACCGCATCCTCCGTGATAGAATTGACCTGTACAAAGACGGTG
GGCAGACCTGCATTCAAGAGGTTTGATATCGACAGCTGCACTTACTACTTCAGCTGGGAC
TCCCGGGCTGCCTGCGCCGTGAAGCCTCAGGAGGTGCAGATGGTGAATGGGACCATCACC
AACCCTATAAATGGCAAGAGCTTCAGCCTCGGAGATATTTATTTTAAGCTGTTCAGAGCC
TCTGGGGACATGAGGACCAATGGGGACAACTACCTGTATGAGATCCAACTTTCCTCCATC
ACAAGCTCCAGAAACCCGGCGTGCTCTGGAGCCAACATATGCCAGGTGAAGCCCAACGAT
CAGCACTTCAGTCGGAAAGTTGGAACCTCTGACAAGACCAAGTACTACCTTCAAGACGGC
GATCTCGATGTCGTGTTTGCCTCTTCCTCTAAGTGCGGAAAGGATAAGACCAAGTCTGTT
TCTTCCACCATCTTCTTCCACTGTGACCCTCTGGTGGAGGACGGGATCCCCGAGTTCAGT
CACGAGACTGCCGACTGCCAGTACCTCTTCTCTTGGTACACCTCAGCCGTGTGTCCTCTG
GGGGTGGGCTTTGACAGCGAGAATCCCGGGGACGACGGGCAGATGCACAAGGGGCTGTCA
GAACGGAGCCAGGCAGTCGGCGCGGTGCTCAGCCTGCTGCTGGTGGCGCTCACCTGCTGC
CTGCTGGCCCTGTTGCTCTACAAGAAGGAGAGGAGGGAAACAGTGATAAGTAAGCTGACC
ACTTGCTGTAGGAGAAGTTCCAACGTGTCCTACAAATACTCAAAGGTGAATAAGGAAGAA
GAGACAGATGAGAATGAAACAGAGTGGCTGATGGAAGAGATCCAGCTGCCTCCTCCACGG
CAGGGAAAGGAAGGGCAGGAGAACGGCCATATTACCACCAAGTCAGTGAAAGCCCTCAGC
TCCCTGCATGGGGATGACCAGGACAGTGAGGATGAGGTTCTGACCATCCCAGAGGTGAAA
GTTCACTCGGGCAGGGGAGCTGGGGCAGAGAGCTCCCACCCAGTGAGAAACGCACAGAGC
AATGCCCTTCAGGAGCGTGAGGACGATAGGGTGGGGCTGGTCAGGGGTGAGAAGGCGAGG
AAAGGGAAGTCCAGCTCTGCACAGCAGAAGACAGTGAGCTCCACCAAGCTGGTGTCCTTC
CATGACGACAGCGACGAGGACCTCTTACACATCTGA
Chromosome Location
6
Locus
6q26
External Identifiers
ResourceLink
UniProtKB IDP11717
UniProtKB Entry NameMPRI_HUMAN
GenBank Protein ID33055
GenBank Gene IDY00285
HGNC IDHGNC:5467
General References
  1. Morgan DO, Edman JC, Standring DN, Fried VA, Smith MC, Roth RA, Rutter WJ: Insulin-like growth factor II receptor as a multifunctional binding protein. Nature. 1987 Sep 24-30;329(6137):301-7. [PubMed:2957598]
  2. Oshima A, Nolan CM, Kyle JW, Grubb JH, Sly WS: The human cation-independent mannose 6-phosphate receptor. Cloning and sequence of the full-length cDNA and expression of functional receptor in COS cells. J Biol Chem. 1988 Feb 15;263(5):2553-62. [PubMed:2963003]
  3. Killian JK, Jirtle RL: Genomic structure of the human M6P/IGF2 receptor. Mamm Genome. 1999 Jan;10(1):74-7. [PubMed:9892739]
  4. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404]
  5. Ikushima H, Munakata Y, Ishii T, Iwata S, Terashima M, Tanaka H, Schlossman SF, Morimoto C: Internalization of CD26 by mannose 6-phosphate/insulin-like growth factor II receptor contributes to T cell activation. Proc Natl Acad Sci U S A. 2000 Jul 18;97(15):8439-44. [PubMed:10900005]
  6. Puertollano R, Aguilar RC, Gorshkova I, Crouch RJ, Bonifacino JS: Sorting of mannose 6-phosphate receptors mediated by the GGAs. Science. 2001 Jun 1;292(5522):1712-6. [PubMed:11387475]
  7. Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. [PubMed:12754519]
  8. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983]
  9. Giorgianni F, Zhao Y, Desiderio DM, Beranova-Giorgianni S: Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line. Electrophoresis. 2007 Jun;28(12):2027-34. [PubMed:17487921]
  10. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336]
  11. Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J: Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment. J Proteome Res. 2008 Dec;7(12):5167-76. [PubMed:19367720]
  12. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976]
  13. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  14. Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J: Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography. Proteomics. 2008 Apr;8(7):1346-61. doi: 10.1002/pmic.200700884. [PubMed:18318008]
  15. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330]
  16. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218]
  17. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195]
  18. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332]
  19. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861]
  20. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  21. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  22. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. [PubMed:21406692]
  23. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  24. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]
  25. Brown J, Delaine C, Zaccheo OJ, Siebold C, Gilbert RJ, van Boxel G, Denley A, Wallace JC, Hassan AB, Forbes BE, Jones EY: Structure and functional analysis of the IGF-II/IGF2R interaction. EMBO J. 2008 Jan 9;27(1):265-76. Epub 2007 Nov 29. [PubMed:18046459]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02900alpha-D-mannose 6-phosphateexperimentalunknownDetails
DB01277Mecaserminapproved, investigationalunknownDetails
DB13173Cerliponase alfaapproved, investigationalunknownligandDetails
DB14751Mecasermin rinfabateapprovedunknownDetails