Genome polyprotein

Details

Name
Genome polyprotein
Synonyms
  • 3.4.21.91
  • NS1
Gene Name
Not Available
Organism
DENV-2
Amino acid sequence
>lcl|BSEQ0010881|Genome polyprotein
MNDQRKKARNTPFNMLKRERNRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIP
PTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRRTAGMIIMLIPTVMAFHLTTR
NGEPHMIVSRQEKGKSLLFKTKDGTNMCTLMAMDLGELCEDTITYKCPFLKQNEPEDIDC
WCNSTSTWVTYGTCTTTGEHRREKRSVALVPHVGMGLETRTETWMSSEGAWKHAQRIETW
ILRHPGFTIMAAILAYTIGTTHFQRVLIFILLTAIAPSMTMRCIGISNRDFVEGVSGGSW
VDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTDSRCPTQGEP
TLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFTCKKNMEGKIVQPENLEYTVV
ITPHSGEEHAVGNDTGKHGKEVKITPQSSITEAELTGYGTVTMECSPRTGLDFNEMVLLQ
MKDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAM
HTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKVVKEIAETQHGTI
VIRVQYEGDGSPCKTPFEIMDLEKRHVLGRLTTVNPIVTEKDSPVNIEAEPPFGDSYIII
GVEPGQLKLDWFKKGSSIGQMFETTMRGAKRMAILGDTAWDFGSLGGVFTSIGKALHQVF
GAIYGAAFSGVSWTMKILIGVIITWIGMNSRSTSLSVSLVLVGIVTLYLGVMVQADSGCV
VSWKNKELKCGSGIFVTDNVHTWTEQYKFQPESPSKLASAIQKAHEEGICGIRSVTRLEN
LMWKQITSELNHILSENEVKLTIMTGDIKGIMQVGKRSLRPQPTELRYSWKTWGKAKMLS
TELHNQTFLIDGPETAECPNTNRAWNSLEVEDYGFGVFTTNIWLRLREKQDAFCDSKLMS
AAIKDNRAVHADMGYWIESALNDTWKIEKASFIEVKSCHWPKSHTLWSNGVLESEMVIPK
NFAGPVSQHNNRPGYHTQTAGPWHLGKLEMDFDFCEGTTVVVTEDCGNRGPSLRTTTASG
KLITEWCCRSCTLPPLRYRGEDGCWYGMEIRPLKEKEENLVSSLVTAGHGQIDNFSLGIL
GMALFLEEMLRTRVGTKHAILLVAVSFVTLITGNMSFRDLGRVMVMVGATMTDDIGMGVT
YLALLAAFKVRPTFAAGLLLRKLTSKELMMTTIGIVLLSQSSIPETILELTDALALGMMV
LKMVRNMEKYQLAVTIMAILCVPNAVILQNAWKVSCTILAVVSVSPLFLTSSQQKADWIP
LALTIKGLNPTAIFLTTLSRTSKKRSWPLNEAIMAVGMVSILASSLLKNDTPMTGPLVAG
GLLTVCYVLTGRSADLELERATDVKWDDQAEISGSSPILSITISEDGSMSIKNEEEEQTL
TILIRTGLLVISGLFPVSIPITAAAWYLWEVKKQRAGVLWDVPSPPPVGKAELEDGAYRI
KQKGILGYSQIGAGVYKEGTFHTMWHVTRGAVLMHKGKRIEPSWADVKKDLISYGGGWKL
EGEWKEGEEVQVLALEPGKNPRAVQTKPGLFRTNTGTIGAVSLDFSPGTSGSPIVDKKGK
VVGLYGNGVVTRSGAYVSAIAQTEKSIEDNPEIEDDIFRKRRLTIMDLHPGAGKTKRYLP
AIVREAIKRGLRTLILAPTRVVAAEMEEALRGLPIRYQTPAIRAEHTGREIVDLMCHATF
TMRLLSPIRVPNYNLIIMDEAHFTDPASIAARGYISTRVEMGEAAGIFMTATPPGSRDPF
PQSNAPIMDEEREIPERSWNSGHEWVTDFKGKTVWFVPSIKTGNDIAACLRKNGKRVIQL
SRKTFDSEYVKTRTNDWDFVVTTDISEMGANFKAERVIDPRRCMKPVILTDGEERVILAG
PMPVTHSSAAQRRGRIGRNPRNENDQYIYMGEPLENDEDCAHWKEAKMLLDNINTPEGII
PSMFEPEREKVDAIDGEYRLRGEARKTFVDLMRRGDLPVWLAYKVAAEGINYADRRWCFD
GTRNNQILEENVEVEIWTKEGERKKLKPRWLDARIYSDPLALKEFAAGRKSLTLNLITEM
GRLPTFMTQKARDALDNLAVLHTAEAGGKAYNHALSELPETLETLLLLTLLATVTGGIFL
FLMSGRGIGKMTLGMCCIITASILLWYAQIQPHWIAASIILEFFLIVLLIPEPEKQRTPQ
DNQLTYVIIAILTVVAATMANEMGFLEKTKKDLGLGNIATQQPESNILDIDLRPASAWTL
YAVATTFITPMLRHSIENSSVNVSLTAIANQATVLMGLGKGWPLSKMDIGVPLLAIGCYS
QVNPITLTAALLLLVAHYAIIGPGLQAKATREAQKRAAAGIMKNPTVDGITVIDLDPIPY
DPKFEKQLGQVMLLVLCVTQVLMMRTTWALCEALTLATGPVSTLWEGNPGRFWNTTIAVS
MANIFRGSYLAGAGLLFSIMKNTTSTRRGTGNIGETLGEKWKSRLNALGKSEFQIYKKSG
IQEVDRTLAKEGIKRGETDHHAVSRGSAKLRWFVERNLVTPEGKVVDLGCGRGGWSYYCG
GLKNVREVKGLTKGGPGHEEPIPMSTYGWNLVRLQSGVDVFFVPPEKCDTLLCDIGESSP
NPTVEAGRTLRVLNLVENWLNNNTQFCVKVLNPYMPSVIERMETLQRKYGGALVRNPLSR
NSTHEMYWVSNASGNIVSSVNMISRMLINRFTMRHKKATYEPDVDLGSGTRNIGIESETP
NLDIIGKRIEKIKQEHETSWHYDQDHPYKTWAYHGSYETKQTGSASSMVNGVVRLLTKPW
DVVPMVTQMAMTDTTPFGQQRVFKEKVDTRTQEPKEGTKKLMKITAEWLWKELGKKKTPR
MCTREEFTKKVRSNAALGAIFTDENKWKSAREAVEDSRFWELVDKERNLHLEGKCETCVY
NMMGKREKKLGEFGKAKGSRAIWYMWLGARFLEFEALGFLNEDHWFSRENSLSGVEGEGL
HKLGYILREVSKKEGGAMYADDTAGWDTRITIEDLKNEEMITNHMAGEHKKLAEAIFKLT
YQNKVVRVQRPTPRGTVMDIISRRDQRGSGQVGTYGLNTFTNMEAQLIRQMEGEGIFKSI
QHLTASEEIAVQDWLARVGRERLSRMAISGDDCVVKPLDDRFARALTALNDMGKVRKDIQ
QWEPSRGWNDWTQVPFCSHHFHELIMKDGRTLVVPCRNQDELIGRARISQGAGWSLRETA
CLGKSYAQMWSLMYFHRRDLRLAANAICSAVPSHWVPTSRTTWSIHASHEWMTTEDMLTV
WNKVWILENPWMEDKTPVESWEEIPYLGKREDQWCGSLIGLTSRATWAKNIQTAINQVRS
LIGNEEYTDYMPSMKRFRREEEEAGVLW
Number of residues
3388
Molecular Weight
379216.195
Theoretical pI
8.67
GO Classification
Functions
ATP binding / ATP-dependent helicase activity / double-stranded RNA binding / metal ion binding / mRNA (guanine-N7-)-methyltransferase activity / mRNA (nucleoside-2'-O-)-methyltransferase activity / RNA helicase activity / RNA-directed RNA polymerase activity / serine-type endopeptidase activity / serine-type exopeptidase activity / structural molecule activity
Processes
clathrin-mediated endocytosis of virus by host cell / fusion of virus membrane with host endosome membrane / induction by virus of host autophagy / regulation of transcription, DNA-templated / suppression by virus of host STAT2 activity / suppression by virus of host TYK2 activity / suppression by virus of host type I interferon-mediated signaling pathway / transcription, DNA-templated / viral RNA genome replication / virion attachment to host cell
Components
extracellular region / host cell endoplasmic reticulum membrane / host cell nucleus / integral component of membrane / viral capsid / viral envelope / virion membrane
General Function
Structural molecule activity
Specific Function
Capsid protein C self-assembles to form an icosahedral capsid about 30 nm in diameter. The capsid encapsulates the genomic RNA.prM acts as a chaperone for envelope protein E during intracellular virion assembly by masking and inactivating envelope protein E fusion peptide. prM is matured in the last step of virion assembly, presumably to avoid catastrophic activation of the viral fusion peptide induced by the acidic pH of the trans-Golgi network. After cleavage by host furin, the pr peptide is released in the extracellular medium and small envelope protein M and envelope protein E homodimers are dissociated.Envelope protein E binding to host cell surface receptor is followed by virus internalization through clathrin-mediated endocytosis. Envelope protein E is subsequently involved in membrane fusion between virion and host late endosomes. Synthesized as a homodimer with prM which acts as a chaperone for envelope protein E. After cleavage of prM, envelope protein E dissociate from small envelope protein M and homodimerizes.Non-structural protein 1 is involved in virus replication and regulation of the innate immune response. Soluble and membrane-associated NS1 may activate human complement and induce host vascular leakage. This effect might explain the clinical manifestations of dengue hemorrhagic fever and dengue shock syndrome.Non-structural protein 2A may be involved viral RNA replication and capsid assembly.Non-structural protein 2B is a required cofactor for the serine protease function of NS3.Serine protease NS3 displays three enzymatic activities: serine protease, NTPase and RNA helicase. NS3 serine protease, in association with NS2B, performs its autocleavage and cleaves the polyprotein at dibasic sites in the cytoplasm: C-prM, NS2A-NS2B, NS2B-NS3, NS3-NS4A, NS4A-2K and NS4B-NS5. NS3 RNA helicase binds RNA and unwinds dsRNA in the 3' to 5' direction (By similarity).Non-structural protein 4A induces host endoplasmic reticulum membrane rearrangements leading to the formation of virus-induced membranous vesicles hosting the dsRNA and polymerase, functioning as a replication complex. NS4A might also regulate the ATPase activity of the NS3 helicase.Peptide 2k functions as a signal peptide for NS4B and is required for the interferon antagonism activity of the latter.Non-structural protein 4B inhibits interferon (IFN)-induced host STAT1 phosphorylation and nuclear translocation, thereby preventing the establishment of cellular antiviral state by blocking the IFN-alpha/beta pathway.RNA-directed RNA polymerase NS5 replicates the viral (+) and (-) genome, and performs the capping of genomes in the cytoplasm. NS5 methylates viral RNA cap at guanine N-7 and ribose 2'-O positions. Besides its role in genome replication, also prevents the establishment of cellular antiviral state by blocking the interferon-alpha/beta (IFN-alpha/beta) signaling pathway. Inhibits host TYK2 and STAT2 phosphorylation, thereby preventing activation of JAK-STAT signaling pathway (By similarity).
Pfam Domain Function
Transmembrane Regions
102-122 239-259 266-280 1125-1145 1157-1177 1185-1205 1272-1292 1318-1338 1347-1367 1371-1391 2145-2165 2190-2210 2226-2246 2345-2365 2411-2431 2457-2477
Cellular Location
Virion
Gene sequence
>lcl|BSEQ0002509|10167 bp
ATGAATGACCAACGGAAAAAGGCGAGAAACACGCCTTTCAATATGCTGAAACGCGAGAGA
AACCGCGTGTCAACTGTACAACAGTTGACAAAGAGATTCTCACTTGGAATGCTGCAGGGA
CGAGGACCACTAAAATTGTTCATGGCCCTGGTGGCATTCCTTCGTTTCCTAACAATCCCA
CCAACAGCAGGGATATTAAAAAGATGGGGAACAATTAAAAAATCAAAGGCTATTAATGTT
CTGAGAGGCTTCAGGAAAGAGATTGGAAGGATGCTGAATATCTTAAACAGGAGACGTAGA
ACTGCAGGCATGATCATCATGCTGATTCCAACAGTGATGGCGTTTCATCTGACCACACGC
AACGGAGAACCACACATGATCGTCAGTAGACAAGAAAAAGGGAAAAGCCTTCTGTTTAAG
ACAAAGGACGGCACGAACATGTGTACCCTCATGGCCATGGACCTTGGTGAGTTGTGTGAA
GACACAATCACGTATAAATGTCCCTTTCTCAAGCAGAACGAACCAGAAGACATAGATTGT
TGGTGCAACTCCACGTCCACATGGGTAACTTATGGGACATGTACCACCACAGGAGAGCAC
AGAAGAGAAAAAAGATCAGTGGCGCTTGTTCCACACGTGGGAATGGGATTGGAGACACGA
ACTGAAACATGGATGTCATCAGAAGGGGCCTGGAAACATGCCCAGAGAATTGAAACTTGG
ATTCTGAGACATCCAGGCTTTACCATAATGGCCGCAATCCTGGCATACACCATAGGAACG
ACGCATTTCCAAAGAGTCCTGATATTCATCCTACTGACAGCCATCGCTCCTTCAATGACA
ATGCGCTGCATAGGAATATCAAATAGGGACTTTGTGGAAGGAGTGTCAGGAGGGAGTTGG
GTTGACATAGTTTTAGAACATGGAAGTTGTGTGACGACGATGGCAAAAAATAAACCAACA
CTGGACTTTGAACTGATAAAAACAGAAGCCAAACAACCCGCCACCTTAAGGAAGTACTGT
ATAGAGGCTAAACTGACCAACACGACAACAGACTCGCGCTGCCCAACACAAGGGGAACCC
ACCCTGAATGAAGAGCAGGACAAAAGGTTTGTCTGCAAACATTCCATGGTAGACAGAGGA
TGGGGAAATGGATGTGGATTATTTGGAAAAGGAGGCATCGTGACCTGTGCCATGTTCACA
TGCAAAAAGAACATGGAGGGAAAAATTGTGCAGCCAGAAAACCTGGAATACACTGTCGTT
ATAACACCTCATTCAGGGGAAGAACATGCAGTCGGAAATGACACAGGAAAACATGGTAAA
GAAGTCAAGATAACACCACAGAGCTCCATCACAGAGGCGGAACTGACAGGCTATGGCACT
GTTACGATGGAGTGCTCTCCAAGAACGGGCCTCGACTTCAATGAGATGGTGTTGCTGCAA
ATGAAAGACAAAGCTTGGCTGGTGCACAGACAATGGTTCCTAGACCTACCGTTGCCATGG
CTGCCCGGAGCAGACACACAAGGATCAAATTGGATACAGAAAGAGACACTGGTCACCTTC
AAAAATCCCCATGCGAAAAAACAGGATGTTGTTGTCTTAGGATCCCAAGAGGGGGCCATG
CATACAGCACTCACAGGGGCTACGGAAATCCAGATGTCATCAGGAAACCTGCTGTTCACA
GGACATCTTAAGTGCAGGCTGAGAATGGACAAATTACAACTTAAAGGGATGTCATACTCC
ATGTGCACAGGAAAGTTTAAAGTTGTGAAGGAAATAGCAGAAACACAACATGGAACAATA
GTCATTAGAGTACAATATGAAGGAGACGGCTCTCCATGCAAGACCCCTTTTGAGATAATG
GATCTGGAAAAAAGACATGTTTTGGGCCGCCTGACCACAGTCAACCCAATTGTAACAGAA
AAGGACAGTCCAGTCAACATAGAAGCAGAACCTCCATTCGGAGACAGCTACATCATCATA
GGAGTGGAACCAGGACAATTGAAGCTGGACTGGTTCAAGAAAGGAAGTTCCATCGGCCAA
ATGTTTGAGACAACAATGAGGGGAGCGAAAAGAATGGCCATTTTGGGCGACACAGCCTGG
GATTTTGGATCTCTGGGAGGAGTGTTCACATCAATAGGAAAGGCTCTCCACCAGGTTTTT
GGAGCAATCTACGGGGCTGCTTTCAGTGGGGTCTCATGGACTATGAAGATCCTCATAGGA
GTTATCATCACATGGATAGGAATGAACTCACGTAGCACATCACTGTCTGTGTCACTGGTA
TTAGTGGGAATCGTGACACTGTACTTGGGAGTTATGGTGCAGGCCGATAGTGGTTGCGTT
GTGAGCTGGAAGAACAAAGAACTAAAATGTGGCAGTGGAATATTCGTCACAGATAACGTG
CATACATGGACAGAACAATACAAGTTCCAACCAGAATCCCCTTCAAAACTGGCTTCAGCC
ATCCAGAAAGCTCATGAAGAGGGCATCTGTGGAATCCGCTCAGTAACAAGACTGGAAAAT
CTTATGTGGAAACAAATAACATCAGAATTGAATCATATTCTATCAGAAAATGAAGTGAAA
CTGACCATCATGACAGGAGACATCAAAGGAATCATGCAGGTAGGAAAACGATCTCTGCGG
CCTCAACCCACTGAGTTGAGGTATTCATGGAAAACATGGGGTAAAGCGAAAATGCTCTCC
ACAGAACTCCATAATCAGACCTTCCTCATTGATGGTCCCGAAACAGCAGAATGCCCCAAC
ACAAACAGAGCTTGGAATTCACTAGAAGTTGAGGACTACGGCTTTGGAGTATTCACTACC
AATATATGGCTAAGATTGAGAGAAAAGCAGGATGCATTTTGTGACTCAAAACTCATGTCA
GCGGCCATAAAGGACAACAGAGCCGTCCATGCTGATATGGGTTATTGGATAGAAAGCGCA
CTCAATGATACATGGAAGATAGAGAAAGCTTCTTTCATTGAAGTCAAAAGTTGCCACTGG
CCAAAGTCACACACTCTATGGAGTAATGGAGTGCTAGAAAGCGAGATGGTAATTCCAAAG
AATTTCGCTGGACCAGTGTCACAACATAATAACAGACCAGGCTATCACACACAAACAGCA
GGACCTTGGCATCTAGGCAAGCTTGAGATGGACTTTGATTTCTGCGAAGGGACTACAGTG
GTGGTAACCGAGGACTGTGGAAACAGAGGGCCCTCTTTAAGAACAACCACTGCCTCAGGA
AAACTCATAACGGAATGGTGTTGTCGATCTTGCACACTACCACCACTAAGATACAGAGGT
GAGGATGGATGCTGGTACGGGATGGAAATCAGACCATTGAAAGAGAAAGAAGAAAATCTG
GTCAGTTCTCTGGTCACAGCCGGACATGGGCAGATTGATAATTTCTCATTAGGAATCTTG
GGAATGGCACTGTTCCTTGAAGAAATGCTCAGGACTCGAGTAGGAACGAAACATGCAATA
TTACTAGTCGCAGTTTCTTTCGTAACGTTAATCACAGGGAACATGTCTTTTAGAGACCTG
GGAAGAGTGATGGTTATGGTGGGTGCCACCATGACAGATGACATAGGCATGGGTGTGACT
TATCTTGCTCTACTAGCAGCTTTCAAAGTCAGACCAACCTTTGCAGCTGGACTGCTCTTG
AGAAAACTGACCTCCAAGGAATTAATGATGACCACCATAGGAATCGTTCTTCTCTCCCAG
AGTAGCATACCAGAGACCATTCTTGAACTGACCGATGCGTTAGCTTTAGGCATGATGGTC
CTCAAGATGGTGAGAAACATGGAAAAATATCAGCTGGCAGTGACCATCATGGCTATTTTG
TGCGTCCCAAATGCTGTGATATTACAGAACGCATGGAAAGTGAGTTGCACAATATTGGCA
GTGGTGTCTGTTTCCCCCCTGTTCTTAACATCCTCACAACAGAAAGCGGACTGGATACCA
TTAGCGTTGACGATCAAAGGCCTCAATCCAACAGCCATTTTTCTAACAACCCTCTCAAGA
ACCAGCAAGAAAAGGAGCTGGCCTTTAAATGAGGCCATCATGGCGGTTGGGATGGTGAGT
ATCTTGGCCAGCTCTCTCTTAAAGAATGACACCCCCATGACAGGACCATTAGTGGCTGGA
GGGCTTCTTACTGTGTGCTACGTACTAACTGGGCGGTCAGCCGATCTGGAACTAGAGAGA
GCTACCGATGTCAAATGGGATGACCAGGCAGAGATATCAGGTAGCAGTCCAATTCTGTCA
ATAACAATATCAGAAGATGGCAGCATGTCAATAAAGAATGAAGAGGAAGAGCAAACATTG
ACTATACTCATTAGAACAGGATTGCTTGTGATCTCAGGACTCTTTCCGGTATCAATACCA
ATTACAGCAGCAGCATGGTACCTGTGGGAAGTAAAGAAACAACGGGCTGGAGTGTTGTGG
GATGTCCCCTCACCACCACCCGTGGGAAAGGCTGAATTGGAAGATGGAGCCTACAGAATC
AAGCAAAAAGGAATCCTTGGATATTCCCAGATCGGAGCTGGAGTTTACAAAGAAGGAACA
TTTCACACAATGTGGCACGTCACACGTGGCGCTGTCCTAATGCATAAGGGGAAGAGGATT
GAACCATCATGGGCGGACGTCAAGAAAGACTTAATATCATATGGAGGAGGTTGGAAGCTA
GAAGGAGAATGGAAAGAAGGAGAAGAAGTCCAGGTCTTGGCATTGGAGCCTGGGAAAAAT
CCAAGAGCCGTCCAAACAAAACCTGGCCTTTTTAGAACCAATACTGGAACCATAGGTGCC
GTATCTCTGGACTTTTCCCCTGGGACGTCAGGATCTCCAATCGTCGACAAAAAAGGAAAA
GTTGTAGGCCTCTATGGCAATGGTGTCGTTACAAGGAGTGGAGCATATGTGAGTGCCATA
GCTCAGACTGAAAAAAGCATTGAAGACAATCCAGAGATTGAAGATGACATCTTTCGAAAG
AGAAGATTGACTATCATGGATCTCCACCCAGGAGCAGGAAAGACAAAGAGATACCTCCCG
GCCATAGTCAGAGAGGCCATAAAAAGAGGCTTGAGAACACTAATCCTAGCCCCCACTAGA
GTCGTGGCAGCTGAAATGGAGGAAGCCCTTAGAGGACTTCCAATAAGATACCAAACTCCA
GCTATCAGGGCTGAGCACACCGGGCGGGAGATTGTGGACTTAATGTGTCATGCCACATTT
ACCATGAGGCTGCTATCACCAATCAGGGTGCCAAATTACAACCTGATCATCATGGACGAA
GCCCATTTTACAGATCCAGCAAGCATAGCAGCTAGGGGATACATCTCAACTCGAGTGGAG
ATGGGTGAGGCAGCTGGAATTTTTATGACAGCCACTCCTCCGGGTAGCAGAGATCCATTT
CCTCAGAGTAATGCACCAATTATGGACGAAGAAAGAGAAATCCCGGAACGTTCATGGAAC
TCCGGGCACGAGTGGGTCACGGATTTTAAAGGAAAGACTGTCTGGTTTGTTCCAAGCATA
AAAACCGGAAATGACATAGCAGCCTGCCTGAGAAAGAATGGAAAGAGGGTGATACAACTC
AGTAGGAAGACCTTTGATTCTGAATATGTCAAGACTAGAACCAATGACTGGGATTTCGTG
GTTACAACTGACATCTCGGAAATGGGTGCCAACTTTAAAGCTGAGAGGGTTATAGACCCC
AGACGCTGCATGAAACCAGTTATACTGACAGACGGCGAAGAGCGGGTGATTCTGGCAGGA
CCCATGCCAGTGACCCACTCTAGTGCAGCACAAAGAAGAGGGAGAATAGGAAGGAATCCA
AGGAATGAAAATGATCAATATATATATATGGGGGAACCCCTGGAAAATGATGAAGACTGT
GCGCACTGGAAGGAAGCTAAGATGCTCCTAGATAACATCAACACACCTGAAGGAATCATT
CCCAGCATGTTCGAGCCAGAGCGTGAAAAGGTGGATGCCATTGACGGTGAATATCGCTTG
AGAGGAGAAGCACGGAAAACTTTTGTGGACCTAATGAGAAGAGGAGACCTACCAGTCTGG
TTGGCTTATAAAGTGGCTGCTGAAGGTATCAACTACGCAGACAGAAGATGGTGTTTTGAC
GGAACCAGAAACAATCAAATCTTGGAAGAAAATGTGGAAGTGGAAATCTGGACAAAGGAA
GGGGAAAGGAAAAAATTGAAACCTAGATGGTTAGATGCTAGGATCTACTCCGACCCACTG
GCGCTAAAAGAATTCGCAGCCGGAAGAAAGTCCCTAACCCTGAACCTAATCACAGAGATG
GGCAGACTCCCAACTTTTATGACTCAGAAGGCCAGAGATGCACTAGACAACTTGGCGGTG
CTGCACACGGCTGAAGCGGGTGGAAAGGCATACAATCATGCTCTCAGTGAACTACCGGAG
ACCCTGGAGACATTGCTTTTGCTGACACTGTTGGCCACAGTCACGGGAGGAATCTTTCTA
TTCCTGATGAGCGGAAGGGGTATAGGGAAGATGACCCTGGGAATGTGCTGCATAATCACG
GCCAGCATCCTCTTATGGTATGCACAAATACAACCACATTGGATAGCAGCTTCAATAATA
TTGGAGTTCTTTCTCATAGTCTTGCTCATTCCAGAACCAGAAAAGCAGAGGACACCCCAG
GATAACCAATTGACTTATGTCATCATAGCCATCCTCACAGTGGTGGCCGCAACCATGGCA
AACGAAATGGGTTTTCTGGAAAAAACAAAGAAAGACCTCGGACTGGGAAACATTGCAACT
CAGCAACCTGAGAGCAACATTCTGGACATAGATCTACGTCCTGCATCAGCATGGACGTTG
TATGCCGTGGCCACAACATTTATCACACCAATGTTGAGACATAGCATTGAAAATTCCTCA
GTAAATGTGTCCCTAACAGCCATAGCTAACCAAGCCACAGTGCTAATGGGTCTCGGGAAA
GGATGGCCATTGTCAAAGATGGACATTGGAGTTCCCCTCCTTGCTATTGGGTGTTACTCA
CAAGTCAACCCTATAACCCTCACAGCGGCTCTTCTTTTATTGGTAGCACATTATGCCATC
ATAGGACCGGGACTTCAAGCCAAAGCAACCAGAGAAGCTCAGAAAAGAGCAGCAGCGGGC
ATCATGAAAAACCCAACTGTGGATGGAATAACAGTGATAGATCTAGATCCAATACCCTAT
GATCCAAAGTTTGAAAAGCAGTTGGGACAAGTAATGCTCCTAGTCCTCTGTGTGACCCAA
GTGCTGATGATGAGGACTACGTGGGCTTTGTGTGAAGCCTTAACTCTAGCAACCGGACCC
GTGTCCACATTGTGGGAAGGAAATCCAGGGAGATTCTGGAACACAACCATTGCAGTGTCA
ATGGCAAACATCTTTAGAGGGAGTTACCTGGCTGGAGCTGGACTTCTCTTTTCTATCATG
AAGAACACAACCAGCACGAGAAGAGGAACTGGCAACATAGGAGAAACGCTAGGAGAGAAA
TGGAAAAGCAGGCTGAACGCATTGGGGAAAAGTGAATTCCAGATCTATAAAAAAAGTGGA
ATTCAAGAAGTGGACAGAACCTTAGCAAAAGAAGGCATTAAAAGAGGAGAAACGGATCAT
CACGCTGTGTCGCGAGGCTCAGCAAAACTGAGATGGTTCGTTGAAAGAAATTTGGTCACA
CCAGAAGGGAAAGTAGTGGACCTTGGTTGCGGCAGAGGGGGCTGGTCATACTATTGTGGA
GGATTAAAGAATGTAAGAGAAGTCAAAGGCTTAACAAAAGGAGGACCAGGACACGAAGAA
CCTATCCCTATGTCAACATATGGGTGGAATCTAGTACGCTTACAGAGCGGAGTTGACGTT
TTTTTTGTTCCACCAGAGAAGTGTGACACATTGTTGTGTGACATAGGGGAATCATCACCA
AATCCCACGGTAGAAGCGGGACGAACACTCAGAGTCCTTAACCTAGTGGAAAATTGGTTG
AACAATAACACCCAATTTTGCGTAAAGGTTCTTAACCCGTACATGCCCTCAGTCATTGAA
AGAATGGAAACCTTACAACGGAAATACGGAGGAGCCTTGGTGAGAAATCCACTCTCACGG
AATTCCACACATGAGATGTACTGGGTGTCCAATGCTTCCGGGAACATAGTGTCATCAGTG
AACATGATTTCAAGAATGCTGATTAACAGATTCACCATGAGACACAAGAAGGCCACCTAT
GAGCCAGATGTCGACCTCGGAAGCGGAACCCGCAATATTGGAATTGAAAGTGAGACACCG
AACCTAGACATAATTGGGAAAAGAATAGAAAAAATAAAACAAGAGCATGAAACGTCATGG
CACTATGACCAAGACCACCCATACAAAACATGGGCTTACCATGGCAGCTATGAAACAAAA
CAGACTGGATCAGCATCATCCATGGTGAACGGAGTAGTCAGATTGCTGACAAAACCCTGG
GACGTTGTTCCAATGGTGACACAGATGGCAATGACAGACACAACTCCTTTCGGACAACAG
CGCGTCTTCAAAGAGAAGGTGGATACGAGAACCCAAGAACCAAAAGAAGGCACAAAAAAA
CTAATGAAAATCACGGCAGAGTGGCTCTGGAAAGAACTAGGAAAGAAAAAGACACCTAGA
ATGTGCACCAGAGAAGAATTCACAAAAAAGGTGAGAAGCAATGCAGCCTTGGGGGCCATA
TTTACCGATGAGAACAAGTGGAAATCGGCGCGTGAGGCTGTTGAAGATAGTAGGTTTTGG
GAGCTGGTTGACAAGGAAAGAAACCTCCATCTTGAAGGGAAATGTGAAACATGTGTATAC
AACATGATGGGAAAAAGAGAGAAAAAACTAGGAGAGTTTGGTAAAGCAAAAGGCAGCAGA
GCCATATGGTACATGTGGCTCGGAGCACGCTTCTTAGAGTTCGAAGCCCTAGGATTTTTG
AATGAAGACCATTGGTTCTCCAGAGAGAACTCCCTGAGTGGAGTAGAAGGAGAAGGGCTG
CATAAGCTAGGTTACATCTTAAGAGAGGTGAGCAAGAAAGAAGGAGGAGCAATGTATGCC
GATGACACCGCAGGCTGGGACACAAGAATCACAATAGAGGATTTAAAAAATGAAGAAATG
ATAACGAACCACATGGCAGGAGAACACAAGAAACTTGCCGAGGCCATTTTTAAATTGACG
TATCAAAACAAGGTGGTGCGTGTGCAAAGACCAACACCAAGAGGCACAGTAATGGACATC
ATATCGAGAAGAGACCAAAGGGGTAGTGGACAAGTTGGTACCTATGGCCTCAACACTTTC
ACCAACATGGAAGCACAACTAATTAGGCAAATGGAGGGGGAAGGAATCTTCAAAAGCATC
CAGCACTTGACAGCCTCAGAAGAAATCGCTGTGCAAGATTGGCTAGCAAGAGTAGGGCGT
GAAAGGTTGTCAAGAATGGCCATCAGTGGAGATGATTGTGTTGTGAAACCTTTAGATGAT
AGATTTGCAAGAGCTCTAACAGCTCTAAATGACATGGGAAAGGTTAGGAAGGACATACAG
CAATGGGAGCCCTCAAGAGGATGGAACGACTGGACACAGGTACCCTTCTGTTCACACCAT
TTTCACGAGTTAATTATGAAAGATGGTCGCACACTCGTAGTTCCATGCAGAAACCAAGAT
GAATTGATCGGCAGAGCCCGAATTTCCCAGGGAGCTGGGTGGTCTTTACGGGAGACGGCC
TGTTTGGGGAAGTCTTACGCCCAAATGTGGAGCTTGATGTACTTCCACAGACGTGATCTC
AGGCTAGCGGCAAATGCCATCTGCTCGGCAGTCCCGTCACACTGGGTTCCAACAAGCCGG
ACAACCTGGTCCATACACGCCAGCCATGAATGGATGACGACGGAAGACATGTTGACAGTT
TGGAACAAAGTGTGGATCCTAGAAAATCCATGGATGGAAGACAAAACTCCAGTGGAATCA
TGGGAGGAAATCCCATACCTGGGAAAAAGAGAAGACCAATGGTGCGGCTCACTGATTGGG
CTGACAAGCAGAGCCACCTGGGCGAAGAATATCCAGACAGCAATAAACCAAGTCAGATCC
CTCATTGGCAATGAGGAATACACAGATTACATGCCATCCATGAAAAGATTCAGAAGAGAA
GAGGAAGAGGCAGGAGTTTTGTGGTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP12823
UniProtKB Entry NamePOLG_DEN2P
GenBank Protein ID323655
GenBank Gene IDM19197
General References
  1. Hahn YS, Galler R, Hunkapiller T, Dalrymple JM, Strauss JH, Strauss EG: Nucleotide sequence of dengue 2 RNA and comparison of the encoded proteins with those of other flaviviruses. Virology. 1988 Jan;162(1):167-80. [PubMed:2827375]
  2. Wright PJ, Cauchi MR, Ng ML: Definition of the carboxy termini of the three glycoproteins specified by dengue virus type 2. Virology. 1989 Jul;171(1):61-7. [PubMed:2741348]
  3. Egloff MP, Benarroch D, Selisko B, Romette JL, Canard B: An RNA cap (nucleoside-2'-O-)-methyltransferase in the flavivirus RNA polymerase NS5: crystal structure and functional characterization. EMBO J. 2002 Jun 3;21(11):2757-68. [PubMed:12032088]
  4. Modis Y, Ogata S, Clements D, Harrison SC: A ligand-binding pocket in the dengue virus envelope glycoprotein. Proc Natl Acad Sci U S A. 2003 Jun 10;100(12):6986-91. Epub 2003 May 20. [PubMed:12759475]
  5. Zhang Y, Corver J, Chipman PR, Zhang W, Pletnev SV, Sedlak D, Baker TS, Strauss JH, Kuhn RJ, Rossmann MG: Structures of immature flavivirus particles. EMBO J. 2003 Jun 2;22(11):2604-13. [PubMed:12773377]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00811RibavirinapprovedunknownDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails