Keratin, type I cytoskeletal 10

Details

Name
Keratin, type I cytoskeletal 10
Synonyms
  • CK-10
  • Cytokeratin-10
  • K10
  • Keratin-10
  • KPP
Gene Name
KRT10
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049836|Keratin, type I cytoskeletal 10
MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRG
SSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGIFGGGSFGGGSFGGGSFGGG
GFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKE
WYEKHGNSHQGEPRDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYEN
EVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTG
DVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISS
YKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQ
IRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGG
GSSGGGHGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGG
GYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY
Number of residues
584
Molecular Weight
58826.915
Theoretical pI
Not Available
GO Classification
Functions
structural constituent of epidermis
Processes
cornification / keratinization / keratinocyte differentiation / peptide cross-linking / skin epidermis development
Components
cornified envelope / cytoplasm / cytosol / extracellular exosome / extracellular space / intermediate filament / membrane / nucleus
General Function
Not Available
Specific Function
Structural constituent of epidermis
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0049837|Keratin, type I cytoskeletal 10 (KRT10)
ATGTCTGTTCGATACAGCTCAAGCAAGCACTACTCTTCCTCCCGCAGTGGAGGAGGAGGA
GGAGGAGGAGGATGTGGAGGAGGAGGAGGAGTGTCATCCCTAAGAATTTCTAGCAGCAAA
GGCTCCCTTGGTGGAGGATTTAGCTCAGGGGGGTTCAGTGGTGGCTCTTTTAGCCGTGGG
AGCTCTGGTGGGGGCTGCTTTGGGGGCTCATCAGGTGGCTATGGAGGATTAGGAGGTTTT
GGTGGAGGTAGCTTTCGTGGAAGCTATGGAAGTAGCAGCTTTGGTGGGAGTTATGGAGGC
AGCTTTGGAGGGGGCAGTTTCGGAGGTGGCAGCTTTGGTGGGGGCAGCTTTGGTGGAGGC
GGCTTTGGTGGAGGCGGCTTTGGAGGAGGCTTTGGTGGTGGATTTGGAGGAGATGGTGGC
CTTCTCTCTGGAAATGAAAAAGTAACCATGCAGAATCTGAATGACCGCCTGGCTTCCTAC
TTGGACAAAGTTCGGGCTCTGGAAGAATCAAACTATGAGCTGGAAGGCAAAATCAAGGAG
TGGTATGAAAAGCATGGCAACTCACATCAGGGGGAGCCTCGTGACTACAGCAAATACTAC
AAAACCATCGATGACCTTAAAAATCAGATTCTCAACCTAACAACTGATAATGCCAACATC
CTGCTTCAGATCGACAATGCCAGGCTGGCAGCTGATGACTTCAGGCTGAAGTATGAGAAT
GAGGTAGCTCTGCGCCAGAGCGTGGAGGCTGACATCAACGGCCTGCGTAGGGTGCTGGAT
GAGCTGACCCTGACCAAGGCTGACCTGGAGATGCAAATTGAGAGCCTGACTGAAGAGCTG
GCCTATCTGAAGAAGAACCACGAGGAGGAAATGAAAGACCTTCGAAATGTGTCCACTGGT
GATGTGAATGTGGAAATGAATGCTGCCCCGGGTGTTGATCTGACTCAACTTCTGAATAAC
ATGAGAAGCCAATATGAACAACTTGCTGAACAAAACCGCAAAGATGCTGAAGCCTGGTTC
AATGAAAAGAGCAAGGAACTGACTACAGAAATTGATAATAACATTGAACAGATATCCAGC
TATAAATCTGAGATTACTGAATTGAGACGTAATGTACAAGCTCTGGAGATAGAACTACAG
TCCCAACTGGCCTTGAAACAATCCCTGGAAGCCTCCTTGGCAGAAACAGAAGGTCGCTAC
TGTGTGCAGCTCTCACAGATTCAGGCCCAGATATCCGCTCTGGAAGAACAGTTGCAACAG
ATTCGAGCTGAAACCGAGTGCCAGAATACTGAATACCAACAACTCCTGGATATTAAGATC
CGACTGGAGAATGAAATTCAAACCTACCGCAGCCTGCTAGAAGGAGAGGGAAGTTCCGGA
GGCGGCGGACGCGGCGGCGGAAGTTTCGGCGGCGGCTACGGCGGCGGAAGCTCCGGCGGC
GGAAGCTCCGGCGGCGGCCACGGCGGCGGCCACGGCGGCAGTTCCGGCGGCGGCTACGGA
GGCGGAAGCTCCGGCGGCGGAAGCTCCGGCGGCGGCTACGGGGGCGGAAGCTCCAGCGGC
GGCCACGGCGGCAGTTCCAGCGGCGGCTACGGTGGTGGCAGTTCCGGCGGCGGCGGCGGC
GGCTACGGGGGCGGCAGCTCCGGCGGCGGCAGCAGCTCCGGCGGCGGATACGGCGGCGGC
AGCTCCAGCGGAGGCCACAAGTCCTCCTCTTCCGGGTCCGTGGGCGAGTCTTCATCTAAG
GGACCAAGATACTAA
Chromosome Location
17
Locus
17q21.2
External Identifiers
ResourceLink
UniProtKB IDP13645
UniProtKB Entry NameK1C10_HUMAN
HGNC IDHGNC:6413
General References
  1. Zhou XM, Idler WW, Steven AC, Roop DR, Steinert PM: The complete sequence of the human intermediate filament chain keratin 10. Subdomainal divisions and model for folding of end domain sequences. J Biol Chem. 1988 Oct 25;263(30):15584-9. [PubMed:2459124]
  2. Rieger M, Franke WW: Identification of an orthologous mammalian cytokeratin gene. High degree of intron sequence conservation during evolution of human cytokeratin 10. J Mol Biol. 1988 Dec 20;204(4):841-56. [PubMed:2464696]
  3. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Darmon MY, Semat A, Darmon MC, Vasseur M: Sequence of a cDNA encoding human keratin No 10 selected according to structural homologies of keratins and their tissue-specific expression. Mol Biol Rep. 1987;12(4):277-83. [PubMed:2448602]
  6. Rothnagel JA, Longley MA, Holder RA, Kuster W, Roop DR: Prenatal diagnosis of epidermolytic hyperkeratosis by direct gene sequencing. J Invest Dermatol. 1994 Jan;102(1):13-6. [PubMed:7507150]
  7. Tkachenko AV, Buchman VL, Bliskovsky VV, Shvets YuP, Kisselev LL: Exons I and VII of the gene (Ker10) encoding human keratin 10 undergo structural rearrangements within repeats. Gene. 1992 Jul 15;116(2):245-51. [PubMed:1378806]
  8. Rasmussen HH, van Damme J, Puype M, Gesser B, Celis JE, Vandekerckhove J: Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes. Electrophoresis. 1992 Dec;13(12):960-9. [PubMed:1286667]
  9. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976]
  10. Choate KA, Lu Y, Zhou J, Choi M, Elias PM, Farhi A, Nelson-Williams C, Crumrine D, Williams ML, Nopper AJ, Bree A, Milstone LM, Lifton RP: Mitotic recombination in patients with ichthyosis causes reversion of dominant mutations in KRT10. Science. 2010 Oct 1;330(6000):94-7. doi: 10.1126/science.1192280. Epub 2010 Aug 26. [PubMed:20798280]
  11. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  12. Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S: Toward a comprehensive characterization of a human cancer cell phosphoproteome. J Proteome Res. 2013 Jan 4;12(1):260-71. doi: 10.1021/pr300630k. Epub 2012 Dec 18. [PubMed:23186163]
  13. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  14. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]
  15. Cheng J, Syder AJ, Yu QC, Letai A, Paller AS, Fuchs E: The genetic basis of epidermolytic hyperkeratosis: a disorder of differentiation-specific epidermal keratin genes. Cell. 1992 Sep 4;70(5):811-9. [PubMed:1381287]
  16. Korge BP, Gan SQ, McBride OW, Mischke D, Steinert PM: Extensive size polymorphism of the human keratin 10 chain resides in the C-terminal V2 subdomain due to variable numbers and sizes of glycine loops. Proc Natl Acad Sci U S A. 1992 Feb 1;89(3):910-4. [PubMed:1371013]
  17. Rothnagel JA, Dominey AM, Dempsey LD, Longley MA, Greenhalgh DA, Gagne TA, Huber M, Frenk E, Hohl D, Roop DR: Mutations in the rod domains of keratins 1 and 10 in epidermolytic hyperkeratosis. Science. 1992 Aug 21;257(5073):1128-30. [PubMed:1380725]
  18. Chipev CC, Yang JM, DiGiovanna JJ, Steinert PM, Marekov L, Compton JG, Bale SJ: Preferential sites in keratin 10 that are mutated in epidermolytic hyperkeratosis. Am J Hum Genet. 1994 Feb;54(2):179-90. [PubMed:7508181]
  19. Syder AJ, Yu QC, Paller AS, Giudice G, Pearson R, Fuchs E: Genetic mutations in the K1 and K10 genes of patients with epidermolytic hyperkeratosis. Correlation between location and disease severity. J Clin Invest. 1994 Apr;93(4):1533-42. [PubMed:7512983]
  20. McLean WH, Eady RA, Dopping-Hepenstal PJ, McMillan JR, Leigh IM, Navsaria HA, Higgins C, Harper JI, Paige DG, Morley SM, et al.: Mutations in the rod 1A domain of keratins 1 and 10 in bullous congenital ichthyosiform erythroderma (BCIE). J Invest Dermatol. 1994 Jan;102(1):24-30. [PubMed:7507152]
  21. Paller AS, Syder AJ, Chan YM, Yu QC, Hutton E, Tadini G, Fuchs E: Genetic and clinical mosaicism in a type of epidermal nevus. N Engl J Med. 1994 Nov 24;331(21):1408-15. [PubMed:7526210]
  22. Joh GY, Traupe H, Metze D, Nashan D, Huber M, Hohl D, Longley MA, Rothnagel JA, Roop DR: A novel dinucleotide mutation in keratin 10 in the annular epidermolytic ichthyosis variant of bullous congenital ichthyosiform erythroderma. J Invest Dermatol. 1997 Mar;108(3):357-61. [PubMed:9036939]
  23. Suga Y, Duncan KO, Heald PW, Roop DR: A novel helix termination mutation in keratin 10 in annular epidermolytic ichthyosis, a variant of bullous congenital ichthyosiform erythroderma. J Invest Dermatol. 1998 Dec;111(6):1220-3. [PubMed:9856845]
  24. Arin MJ, Longley MA, Anton-Lamprecht I, Kurze G, Huber M, Hohl D, Rothnagel JA, Roop DR: A novel substitution in keratin 10 in epidermolytic hyperkeratosis. J Invest Dermatol. 1999 Apr;112(4):506-8. [PubMed:10201536]
  25. Arin MJ, Oji V, Emmert S, Hausser I, Traupe H, Krieg T, Grimberg G: Expanding the keratin mutation database: novel and recurrent mutations and genotype-phenotype correlations in 28 patients with epidermolytic ichthyosis. Br J Dermatol. 2011 Feb;164(2):442-7. doi: 10.1111/j.1365-2133.2010.10096.x. [PubMed:21271994]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09130Copperapproved, investigationalunknownDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails