Sodium/glucose cotransporter 1

Details

Name
Sodium/glucose cotransporter 1
Synonyms
  • High affinity sodium-glucose cotransporter
  • Na(+)/glucose cotransporter 1
  • NAGT
  • SGLT1
  • Solute carrier family 5 member 1
Gene Name
SLC5A1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008603|Sodium/glucose cotransporter 1
MDSSTWSPKTTAVTRPVETHELIRNAADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFL
AGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIY
IKAGVVTMPEYLRKRFGGQRIQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLA
IFLLLAITALYTITGGLAAVIYTDTLQTVIMLVGSLILTGFAFHEVGGYDAFMEKYMKAI
PTIVSDGNTTFQEKCYTPRADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQR
CLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVG
CTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEK
ELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRV
NEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFIT
IVVISLLTKPIPDVHLYRLCWSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKG
IFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGIILVTVAVFCH
AYFA
Number of residues
664
Molecular Weight
73497.275
Theoretical pI
Not Available
GO Classification
Functions
glucose
Processes
carbohydrate metabolic process / glucose transmembrane transport / glucose transport / hexose transport / intestinal absorption / metanephros development / small molecule metabolic process / transmembrane transport
Components
apical plasma membrane / brush border membrane / cell-cell junction / extracellular exosome / integral component of plasma membrane / plasma membrane
General Function
Glucose:sodium symporter activity
Specific Function
Actively transports glucose into cells by Na(+) cotransport with a Na(+) to glucose coupling ratio of 2:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
Pfam Domain Function
Transmembrane Regions
29-49 65-85 106-126 143-163 179-201 209-229 278-298 314-334 381-401 424-444 456-476 485-505 644-664
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0017525|Sodium/glucose cotransporter 1 (SLC5A1)
ATGGACAGTAGCACCTGGAGCCCCAAGACCACCGCGGTCACCCGGCCTGTTGAGACCCAC
GAGCTCATTCGCAATGCAGCCGATATCTCCATCATCGTTATCTACTTCGTGGTAGTGATG
GCCGTCGGACTGTGGGCTATGTTTTCCACCAATCGTGGGACTGTTGGAGGCTTCTTCCTG
GCAGGCCGAAGTATGGTGTGGTGGCCGATTGGAGCCTCCCTCTTTGCTAGTAACATTGGA
AGTGGCCACTTTGTGGGGCTGGCCGGGACTGGGGCAGCTTCAGGCATCGCCATTGGAGGC
TTTGAATGGAATGCCCTGGTTTTGGTGGTTGTGCTGGGCTGGCTGTTTGTCCCCATCTAT
ATTAAGGCTGGGGTGGTGACAATGCCAGAGTACCTGAGGAAGCGGTTTGGAGGCCAGCGG
ATCCAGGTCTACCTTTCCCTTCTGTCCCTGCTGCTCTACATTTTCACCAAGATCTCGGCA
GACATCTTCTCGGGGGCCATATTCATCAATCTGGCCTTAGGCCTGAATCTGTATTTAGCC
ATCTTTCTCTTATTGGCAATCACTGCCCTTTACACAATTACAGGGGGCCTGGCGGCGGTG
ATTTACACGGACACCTTGCAGACGGTGATCATGCTGGTGGGGTCTTTAATCCTGACTGGG
TTTGCTTTTCACGAAGTGGGAGGCTATGACGCCTTCATGGAAAAGTACATGAAAGCCATT
CCAACCATAGTGTCTGATGGCAACACCACCTTTCAGGAAAAATGCTACACTCCAAGGGCC
GACTCCTTCCACATCTTCCGAGATCCCCTCACGGGAGACCTCCCATGGCCTGGGTTCATC
TTTGGGATGTCCATCCTTACCTTGTGGTACTGGTGCACAGATCAGGTCATTGTGCAGCGC
TGCCTCTCAGCCAAGAATATGTCTCACGTGAAGGGTGGCTGCATCCTGTGTGGGTATCTA
AAGCTGATGCCCATGTTCATCATGGTGATGCCAGGAATGATCAGCCGCATTCTGTACACA
GAAAAAATTGCCTGTGTCGTCCCTTCAGAATGTGAGAAATATTGCGGTACCAAGGTTGGC
TGTACCAACATCGCCTATCCAACCTTAGTGGTGGAGCTCATGCCCAATGGACTGCGAGGC
CTGATGCTATCAGTCATGCTGGCCTCCCTCATGAGCTCCCTGACCTCCATCTTCAACAGC
GCCAGCACCCTCTTCACCATGGACATCTACGCCAAGGTCCGCAAGAGAGCATCTGAGAAA
GAGCTCATGATTGCCGGAAGGTTGTTTATCCTGGTGCTGATTGGCATCAGCATCGCCTGG
GTGCCCATTGTGCAGTCAGCACAAAGTGGGCAACTCTTCGATTACATCCAGTCCATCACC
AGTTACTTGGGACCACCCATTGCGGCTGTCTTCCTGCTTGCTATTTTCTGGAAGAGAGTC
AATGAGCCAGGAGCCTTTTGGGGACTGATCCTAGGACTTCTGATTGGGATTTCACGTATG
ATTACTGAGTTTGCTTATGGAACCGGGAGCTGCATGGAGCCCAGCAACTGTCCCACGATT
ATCTGTGGGGTGCACTACTTGTACTTTGCCATTATCCTCTTCGCCATTTCTTTCATCACC
ATCGTGGTCATCTCCCTCCTCACCAAACCCATTCCGGATGTGCATCTCTACCGTCTGTGT
TGGAGCCTGCGCAACAGCAAAGAGGAGCGTATTGACCTGGATGCGGAAGAGGAGAACATC
CAAGAAGGCCCTAAGGAGACCATTGAAATAGAAACACAAGTTCCTGAGAAGAAAAAAGGA
ATCTTCAGGAGAGCCTATGACCTATTTTGTGGGCTAGAGCAGCACGGTGCACCCAAGATG
ACTGAGGAAGAGGAGAAAGCCATGAAGATGAAGATGACGGACACCTCTGAGAAGCCTTTG
TGGAGGACAGTGTTGAACGTCAATGGCATCATCCTGGTGACCGTGGCTGTCTTTTGCCAT
GCATATTTTGCCTGA
Chromosome Location
22
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP13866
UniProtKB Entry NameSC5A1_HUMAN
HGNC IDHGNC:11036
General References
  1. Hediger MA, Turk E, Wright EM: Homology of the human intestinal Na+/glucose and Escherichia coli Na+/proline cotransporters. Proc Natl Acad Sci U S A. 1989 Aug;86(15):5748-52. [PubMed:2490366]
  2. Turk E, Martin MG, Wright EM: Structure of the human Na+/glucose cotransporter gene SGLT1. J Biol Chem. 1994 May 27;269(21):15204-9. [PubMed:8195156]
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  5. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208]
  6. Turk E, Kerner CJ, Lostao MP, Wright EM: Membrane topology of the human Na+/glucose cotransporter SGLT1. J Biol Chem. 1996 Jan 26;271(4):1925-34. [PubMed:8567640]
  7. Turk E, Zabel B, Mundlos S, Dyer J, Wright EM: Glucose/galactose malabsorption caused by a defect in the Na+/glucose cotransporter. Nature. 1991 Mar 28;350(6316):354-6. [PubMed:2008213]
  8. Lam JT, Martin MG, Turk E, Hirayama BA, Bosshard NU, Steinmann B, Wright EM: Missense mutations in SGLT1 cause glucose-galactose malabsorption by trafficking defects. Biochim Biophys Acta. 1999 Feb 24;1453(2):297-303. [PubMed:10036327]
  9. Kasahara M, Maeda M, Hayashi S, Mori Y, Abe T: A missense mutation in the Na(+)/glucose cotransporter gene SGLT1 in a patient with congenital glucose-galactose malabsorption: normal trafficking but inactivation of the mutant protein. Biochim Biophys Acta. 2001 May 31;1536(2-3):141-7. [PubMed:11406349]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09341Dextrose, unspecified formapproved, vet_approvedunknownsubstrateDetails
DB01914D-glucoseapproved, investigational, vet_approvednosubstrateDetails
DB00766Clavulanic acidapproved, vet_approvedunknowninducerDetails