Cytochrome c551 peroxidase

Details

Name
Cytochrome c551 peroxidase
Synonyms
  • 1.11.1.5
  • CCP
Gene Name
ccpA
Organism
Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
Amino acid sequence
>lcl|BSEQ0020647|Cytochrome c551 peroxidase
MQSSQLLPLGSLLLSFATPLAQADALHDQASALFKPIPEQVTELRGQPISEQQRELGKKL
FFDPRLSRSHVLSCNTCHNVGTGGADNVPTSVGHGWQKGPRNSPTVFNAVFNAAQFWDGR
AKDLGEQAKGPIQNSVEMHSTPQLVEQTLGSIPEYVDAFRKAFPKAGKPVSFDNMALAIE
AYEATLVTPDSPFDLYLKGDDKALDAQQKKGLKAFMDSGCSACHNGINLGGQAYFPFGLV
KKPDASVLPSGDKGRFAVTKTQSDEYVFRAAPLRNVALTAPYFHSGQVWELKDAVAIMGN
AQLGKQLAPDDVENIVAFLHSLSGKQPRVEYPLLPASTETTPRPAE
Number of residues
346
Molecular Weight
37403.035
Theoretical pI
6.72
GO Classification
Functions
cytochrome-c peroxidase activity / electron carrier activity / heme binding / metal ion binding
Components
periplasmic space
General Function
Metal ion binding
Specific Function
Catalyzes the peroxidative oxidation of azurin and cytochrome c551. Likely to provide protection against toxic peroxides.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Periplasm
Gene sequence
>lcl|BSEQ0020648|Cytochrome c551 peroxidase (ccpA)
ATGCAGTCCTCGCAACTGCTCCCGCTTGGCAGCCTGTTGCTGTCGTTCGCCACGCCCCTC
GCCCAGGCCGATGCCCTGCACGACCAGGCCAGCGCGCTGTTCAAACCCATCCCCGAGCAG
GTCACCGAGCTGCGCGGCCAGCCCATCAGCGAGCAACAGCGCGAACTCGGCAAGAAACTG
TTCTTCGACCCGCGCCTGTCGCGCAGCCATGTGCTCAGCTGCAACACCTGCCACAACGTC
GGCACCGGCGGCGCCGACAACGTACCGACGTCGGTCGGTCACGGCTGGCAGAAGGGGCCA
CGCAATTCGCCGACGGTCTTCAACGCCGTGTTCAATGCCGCGCAGTTCTGGGATGGCCGC
GCCAAGGACCTGGGGGAGCAGGCCAAGGGTCCGATCCAGAACAGCGTCGAGATGCACAGT
ACCCCGCAGTTGGTCGAACAGACCCTGGGCAGCATCCCGGAATACGTGGACGCCTTCCGC
AAGGCCTTCCCCAAGGCCGGCAAGCCGGTCAGCTTCGACAACATGGCGCTGGCCATCGAG
GCCTACGAGGCGACCCTGGTGACTCCGGACTCGCCCTTCGACCTGTATCTCAAGGGCGAC
GACAAGGCCCTCGACGCACAGCAGAAGAAAGGCCTCAAGGCATTCATGGACAGTGGCTGC
AGCGCCTGCCACAACGGCATCAACCTGGGCGGCCAGGCCTACTTCCCGTTCGGCCTGGTG
AAGAAGCCCGACGCCAGCGTGCTGCCCAGCGGCGACAAGGGCCGCTTCGCCGTGACCAAG
ACCCAGAGCGACGAGTACGTATTCCGCGCCGCGCCCCTGCGCAACGTCGCCCTCACCGCG
CCGTACTTCCACAGCGGCCAGGTCTGGGAACTCAAGGACGCGGTGGCGATCATGGGCAAC
GCCCAGCTCGGCAAGCAGTTGGCGCCGGACGACGTGGAGAACATCGTCGCCTTCCTGCAC
AGCCTGAGCGGCAAGCAGCCGCGCGTCGAATATCCGCTGCTGCCGGCCAGCACGGAGACC
ACGCCGCGTCCCGCGGAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP14532
UniProtKB Entry NameCCPR_PSEAE
GenBank Gene IDU23766
General References
  1. Ridout CJ, James R, Greenwood C: Nucleotide sequence encoding the di-haem cytochrome c551 peroxidase from Pseudomonas aeruginosa. FEBS Lett. 1995 May 29;365(2-3):152-4. [PubMed:7781769]
  2. Stover CK, Pham XQ, Erwin AL, Mizoguchi SD, Warrener P, Hickey MJ, Brinkman FS, Hufnagle WO, Kowalik DJ, Lagrou M, Garber RL, Goltry L, Tolentino E, Westbrock-Wadman S, Yuan Y, Brody LL, Coulter SN, Folger KR, Kas A, Larbig K, Lim R, Smith K, Spencer D, Wong GK, Wu Z, Paulsen IT, Reizer J, Saier MH, Hancock RE, Lory S, Olson MV: Complete genome sequence of Pseudomonas aeruginosa PAO1, an opportunistic pathogen. Nature. 2000 Aug 31;406(6799):959-64. [PubMed:10984043]
  3. Samyn B, Van Craenenbroeck K, De Smet L, Vandenberghe I, Pettigrew G, Van Beeumen J: A reinvestigation of the covalent structure of Pseudomonas aeruginosa cytochrome c peroxidase. FEBS Lett. 1995 Dec 18;377(2):145-9. [PubMed:8543038]
  4. Ronnberg M, Kalkkinen N, Ellfolk N: The primary structure of Pseudomonas cytochrome c peroxidase. FEBS Lett. 1989 Jul 3;250(2):175-8. [PubMed:2546794]
  5. Ronnberg M: Amino acid sequences of the two heme c-binding sites of Pseudomonas cytochrome-c peroxidase. Biochim Biophys Acta. 1987 Mar 18;912(1):82-6. [PubMed:3030432]
  6. Ellfolk N, Ronnberg M, Osterlund K: Structural and functional features of Pseudomonas cytochrome c peroxidase. Biochim Biophys Acta. 1991 Oct 11;1080(1):68-77. [PubMed:1657179]
  7. Fulop V, Ridout CJ, Greenwood C, Hajdu J: Crystal structure of the di-haem cytochrome c peroxidase from Pseudomonas aeruginosa. Structure. 1995 Nov 15;3(11):1225-33. [PubMed:8591033]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails