Modification methylase RsrI

Details

Name
Modification methylase RsrI
Synonyms
  • 2.1.1.72
  • Adenine-specific methyltransferase RsrI
  • M.RsrI
Gene Name
rsrIM
Organism
Rhodobacter sphaeroides
Amino acid sequence
>lcl|BSEQ0011023|Modification methylase RsrI
MANRSHHNAGHRAMNALRKSGQKHSSESQLGSSEIGTTRHVYDVCDCLDTLAKLPDDSVQ
LIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLI
SIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYD
EETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALS
HPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLQDDGLIDKARSYE
IVEGAANFGAALQRGDVAS
Number of residues
319
Molecular Weight
35654.88
Theoretical pI
7.06
GO Classification
Functions
DNA binding / N-methyltransferase activity / site-specific DNA-methyltransferase (adenine-specific) activity
Processes
DNA restriction-modification system
General Function
Site-specific dna-methyltransferase (adenine-specific) activity
Specific Function
This methylase recognizes the double-stranded sequence GAATTC, causes specific methylation on A-? on both strands, and protects the DNA from cleavage by the RsrI endonuclease.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0002889|960 bp
ATGGCAAACCGATCTCACCACAATGCGGGCCACCGAGCGATGAACGCTCTCCGCAAGTCA
GGCCAAAAGCATTCGTCCGAGTCTCAGTTGGGATCTTCGGAGATCGGAACCACACGACAT
GTGTATGACGTTTGCGATTGCCTCGACACCTTGGCGAAGCTGCCCGACGACTCCGTCCAG
TTGATCATTTGTGATCCTCCATACAACATCATGCTGGCGGACTGGGATGATCACATGGAC
TACATCGGCTGGGCGAAGCGATGGCTAGCCGAAGCCGAGCGTGTTCTATCCCCAACGGGC
AGCATAGCGATTTTCGGCGGCCTACAATACCAAGGGGAGGCTGGTTCAGGTGATCTGATC
TCAATCATTTCGCACATGAGACAAAACAGCAAAATGCTGCTCGCAAACCTTATCATCTGG
AACTATCCGAACGGCATGAGTGCGCAGCGCTTCTTTGCAAATAGGCACGAGGAAATCGCG
TGGTTCGCCAAGACCAAGAAGTATTTCTTCGATCTTGACGCTGTGCGGGAACCATATGAC
GAGGAAACCAAAGCCGCTTACATGAAGGACAAGCGGTTGAACCCTGAGTCGGTTGAAAAG
GGACGCAACCCAACAAACGTGTGGCGGATGTCTCGGCTTAACGGCAATTCTCTTGAACGT
GTCGGCCACCCCACGCAAAAACCAGCCGCAGTGATTGAGAGACTGGTTCGCGCGTTGTCG
CATCCGGGTTCAACGGTCCTCGATTTTTTTGCTGGAAGTGGGGTAACGGCGCGCGTTGCA
ATTCAAGAGGGACGGAACAGCATTTGCACTGACGCCGCGCCTGTATTCAAAGAATATTAC
CAGAAGCAGCTAACTTTCCTTCAAGATGATGGACTGATCGACAAAGCGCGATCATATGAA
ATTGTTGAAGGGGCTGCGAACTTTGGTGCAGCATTGCAGCGGGGAGATGTTGCTTCATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP14751
UniProtKB Entry NameMTR1_RHOSH
GenBank Protein ID46455
GenBank Gene IDX16456
General References
  1. Kaszubska W, Aiken C, O'Connor CD, Gumport RI: Purification, cloning and sequence analysis of RsrI DNA methyltransferase: lack of homology between two enzymes, RsrI and EcoRI, that methylate the same nucleotide in identical recognition sequences. Nucleic Acids Res. 1989 Dec 25;17(24):10403-25. [PubMed:2690017]
  2. Stephenson FH, Greene PJ: Nucleotide sequence of the gene encoding the RsrI methyltransferase. Nucleic Acids Res. 1989 Dec 25;17(24):10503. [PubMed:2602165]
  3. Scavetta RD, Thomas CB, Walsh MA, Szegedi S, Joachimiak A, Gumport RI, Churchill ME: Structure of RsrI methyltransferase, a member of the N6-adenine beta class of DNA methyltransferases. Nucleic Acids Res. 2000 Oct 15;28(20):3950-61. [PubMed:11024175]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails
DB01910SinefunginexperimentalunknownDetails
DB022825'-Deoxy-5'-MethylthioadenosineexperimentalunknownDetails