Interleukin-1 receptor type 1

Details

Name
Interleukin-1 receptor type 1
Synonyms
  • CD121 antigen-like family member A
  • IL-1R-1
  • IL-1R-alpha
  • IL1R
  • IL1RA
  • IL1RT1
  • Interleukin-1 receptor alpha
  • Interleukin-1 receptor type I
  • p80
Gene Name
IL1R1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0018975|Interleukin-1 receptor type 1
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKD
DSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNL
CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDR
LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL
GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFK
IDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQ
DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPV
QRRSPSSKHQLLSPATKEKLQREAHVPLG
Number of residues
569
Molecular Weight
65401.91
Theoretical pI
7.89
GO Classification
Functions
interleukin-1 receptor activity / interleukin-1, Type I, activating receptor activity / platelet-derived growth factor receptor binding / signal transducer activity / transmembrane signaling receptor activity
Processes
cell surface receptor signaling pathway / cellular response to glucose stimulus / heat acclimation / immune response / interleukin-1-mediated signaling pathway / ovulation / regulation of inflammatory response / response to epidermal growth factor / response to interleukin-1 / response to nitric oxide / response to radiation / response to transforming growth factor beta
Components
axon / cell surface / extracellular space / integral component of plasma membrane / membrane / nucleus / plasma membrane / postsynaptic density / protein complex
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for IL1A, IL1B and IL1RN. After binding to interleukin-1 associates with the corecptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B, MAPK and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Binds ligands with comparable affinity and binding of antagonist IL1RN prevents association with IL1RAP to form a signaling complex.
Pfam Domain Function
Transmembrane Regions
337-356
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0018976|Interleukin-1 receptor type 1 (IL1R1)
ATGAAAGTGTTACTCAGACTTATTTGTTTCATAGCTCTACTGATTTCTTCTCTGGAGGCT
GATAAATGCAAGGAACGTGAAGAAAAAATAATTTTAGTGTCATCTGCAAATGAAATTGAT
GTTCGTCCCTGTCCTCTTAACCCAAATGAACACAAAGGCACTATAACTTGGTATAAAGAT
GACAGCAAGACACCTGTATCTACAGAACAAGCCTCCAGGATTCATCAACACAAAGAGAAA
CTTTGGTTTGTTCCTGCTAAGGTGGAGGATTCAGGACATTACTATTGCGTGGTAAGAAAT
TCATCTTACTGCCTCAGAATTAAAATAAGTGCAAAATTTGTGGAGAATGAGCCTAACTTA
TGTTATAATGCACAAGCCATATTTAAGCAGAAACTACCCGTTGCAGGAGACGGAGGACTT
GTGTGCCCTTATATGGAGTTTTTTAAAAATGAAAATAATGAGTTACCTAAATTACAGTGG
TATAAGGATTGCAAACCTCTACTTCTTGACAATATACACTTTAGTGGAGTCAAAGATAGG
CTCATCGTGATGAATGTGGCTGAAAAGCATAGAGGGAACTATACTTGTCATGCATCCTAC
ACATACTTGGGCAAGCAATATCCTATTACCCGGGTAATAGAATTTATTACTCTAGAGGAA
AACAAACCCACAAGGCCTGTGATTGTGAGCCCAGCTAATGAGACAATGGAAGTAGACTTG
GGATCCCAGATACAATTGATCTGTAATGTCACCGGCCAGTTGAGTGACATTGCTTACTGG
AAGTGGAATGGGTCAGTAATTGATGAAGATGACCCAGTGCTAGGGGAAGACTATTACAGT
GTGGAAAATCCTGCAAACAAAAGAAGGAGTACCCTCATCACAGTGCTTAATATATCGGAA
ATTGAAAGTAGATTTTATAAACATCCATTTACCTGTTTTGCCAAGAATACACATGGTATA
GATGCAGCATATATCCAGTTAATATATCCAGTCACTAATTTCCAGAAGCACATGATTGGT
ATATGTGTCACGTTGACAGTCATAATTGTGTGTTCTGTTTTCATCTATAAAATCTTCAAG
ATTGACATTGTGCTTTGGTACAGGGATTCCTGCTATGATTTTCTCCCAATAAAAGCTTCA
GATGGAAAGACCTATGACGCATATATACTGTATCCAAAGACTGTTGGGGAAGGGTCTACC
TCTGACTGTGATATTTTTGTGTTTAAAGTCTTGCCTGAGGTCTTGGAAAAACAGTGTGGA
TATAAGCTGTTCATTTATGGAAGGGATGACTACGTTGGGGAAGACATTGTTGAGGTCATT
AATGAAAACGTAAAGAAAAGCAGAAGACTGATTATCATTTTAGTCAGAGAAACATCAGGC
TTCAGCTGGCTGGGTGGTTCATCTGAAGAGCAAATAGCCATGTATAATGCTCTTGTTCAG
GATGGAATTAAAGTTGTCCTGCTTGAGCTGGAGAAAATCCAAGACTATGAGAAAATGCCA
GAATCGATTAAATTCATTAAGCAGAAACATGGGGCTATCCGCTGGTCAGGGGACTTTACA
CAGGGACCACAGTCTGCAAAGACAAGGTTCTGGAAGAATGTCAGGTACCACATGCCAGTC
CAGCGACGGTCACCTTCATCTAAACACCAGTTACTGTCACCAGCCACTAAGGAGAAACTG
CAAAGAGAGGCTCACGTGCCTCTCGGGTAG
Chromosome Location
2
Locus
2q12
External Identifiers
ResourceLink
UniProtKB IDP14778
UniProtKB Entry NameIL1R1_HUMAN
GenBank Protein ID33801
GenBank Gene IDX16896
GenAtlas IDIL1R1
HGNC IDHGNC:5993
General References
  1. Chua AO, Gubler U: Sequence of the cDNA for the human fibroblast type interleukin-1 receptor. Nucleic Acids Res. 1989 Dec 11;17(23):10114. [PubMed:2532321]
  2. Sims JE, Acres RB, Grubin CE, McMahan CJ, Wignall JM, March CJ, Dower SK: Cloning the interleukin 1 receptor from human T cells. Proc Natl Acad Sci U S A. 1989 Nov;86(22):8946-50. [PubMed:2530587]
  3. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Svenson M, Hansen MB, Heegaard P, Abell K, Bendtzen K: Specific binding of interleukin 1 (IL-1) beta and IL-1 receptor antagonist (IL-1ra) to human serum. High-affinity binding of IL-1ra to soluble IL-1 receptor type I. Cytokine. 1993 Sep;5(5):427-35. [PubMed:8142597]
  6. Giri JG, Wells J, Dower SK, McCall CE, Guzman RN, Slack J, Bird TA, Shanebeck K, Grabstein KH, Sims JE, et al.: Elevated levels of shed type II IL-1 receptor in sepsis. Potential role for type II receptor in regulation of IL-1 responses. J Immunol. 1994 Dec 15;153(12):5802-9. [PubMed:7989776]
  7. Huang J, Gao X, Li S, Cao Z: Recruitment of IRAK to the interleukin 1 receptor complex requires interleukin 1 receptor accessory protein. Proc Natl Acad Sci U S A. 1997 Nov 25;94(24):12829-32. [PubMed:9371760]
  8. Marmiroli S, Bavelloni A, Faenza I, Sirri A, Ognibene A, Cenni V, Tsukada J, Koyama Y, Ruzzene M, Ferri A, Auron PE, Toker A, Maraldi NM: Phosphatidylinositol 3-kinase is recruited to a specific site in the activated IL-1 receptor I. FEBS Lett. 1998 Oct 30;438(1-2):49-54. [PubMed:9821957]
  9. Slack JL, Schooley K, Bonnert TP, Mitcham JL, Qwarnstrom EE, Sims JE, Dower SK: Identification of two major sites in the type I interleukin-1 receptor cytoplasmic region responsible for coupling to pro-inflammatory signaling pathways. J Biol Chem. 2000 Feb 18;275(7):4670-8. [PubMed:10671496]
  10. Vigers GP, Anderson LJ, Caffes P, Brandhuber BJ: Crystal structure of the type-I interleukin-1 receptor complexed with interleukin-1beta. Nature. 1997 Mar 13;386(6621):190-4. [PubMed:9062193]
  11. Schreuder H, Tardif C, Trump-Kallmeyer S, Soffientini A, Sarubbi E, Akeson A, Bowlin T, Yanofsky S, Barrett RW: A new cytokine-receptor binding mode revealed by the crystal structure of the IL-1 receptor with an antagonist. Nature. 1997 Mar 13;386(6621):194-200. [PubMed:9062194]
  12. Vigers GP, Dripps DJ, Edwards CK 3rd, Brandhuber BJ: X-ray crystal structure of a small antagonist peptide bound to interleukin-1 receptor type 1. J Biol Chem. 2000 Nov 24;275(47):36927-33. [PubMed:10903327]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00026AnakinraapprovedyesantagonistDetails
DB05207SD118investigationalunknownDetails
DB05303OMS-103HPinvestigationalunknownDetails
DB10770Foreskin fibroblast (neonatal)approvedunknownagonistDetails