Junction plakoglobin

Details

Name
Junction plakoglobin
Synonyms
  • Catenin gamma
  • CTNNG
  • Desmoplakin III
  • Desmoplakin-3
  • DP3
Gene Name
JUP
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049878|Junction plakoglobin
MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTT
YTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPS
QLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALM
GSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVE
SVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
ESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKH
LTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC
NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNY
GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQR
HVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENI
QRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDY
RKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDMDATYRPMYSSDVPLDPLEMHMDM
DGDYPIDTYSDGLRPPYPTADHMLA
Number of residues
745
Molecular Weight
81743.98
Theoretical pI
Not Available
GO Classification
Functions
alpha-catenin binding / cadherin binding / cell adhesion molecule binding / cell adhesive protein binding involved in bundle of His cell-Purkinje myocyte communication / protein homodimerization activity / protein kinase binding / protein phosphatase binding / signal transducer activity / structural constituent of cell wall / structural molecule activity / transcription coactivator activity
Processes
adherens junction assembly / adherens junction organization / bundle of His cell-Purkinje myocyte adhesion involved in cell communication / cell migration / cellular response to indole-3-methanol / cornification / cytoskeletal anchoring at plasma membrane / desmosome assembly / detection of mechanical stimulus / endothelial cell-cell adhesion / establishment of protein localization to plasma membrane / keratinization / neutrophil degranulation / positive regulation of canonical Wnt signaling pathway / positive regulation of protein import into nucleus / positive regulation of sequence-specific DNA binding transcription factor activity / protein heterooligomerization / regulation of cell proliferation / regulation of heart rate by cardiac conduction / regulation of ventricular cardiac muscle cell action potential / single organismal cell-cell adhesion
Components
actin cytoskeleton / apicolateral plasma membrane / catenin complex / cell-cell adherens junction / cell-cell junction / cornified envelope / cytoplasm / cytoplasmic side of plasma membrane / cytoskeleton / cytosol / desmosome / extracellular exosome / extracellular matrix / extracellular region / fascia adherens / ficolin-1-rich granule lumen / focal adhesion / gamma-catenin-TCF7L2 complex / intercalated disc / intermediate filament / lateral plasma membrane / nucleus / plasma membrane / protein-DNA complex / specific granule lumen / Z disc / zonula adherens
General Function
Common junctional plaque protein. The membrane-associated plaques are architectural elements in an important strategic position to influence the arrangement and function of both the cytoskeleton and the cells within the tissue. The presence of plakoglobin in both the desmosomes and in the intermediate junctions suggests that it plays a central role in the structure and function of submembranous plaques. Acts as a substrate for VE-PTP and is required by it to stimulate VE-cadherin function in endothelial cells. Can replace beta-catenin in E-cadherin/catenin adhesion complexes which are proposed to couple cadherins to the actin cytoskeleton (By similarity).
Specific Function
Alpha-catenin binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell junction
Gene sequence
>lcl|BSEQ0049879|Junction plakoglobin (JUP)
ATGGAGGTGATGAACCTGATGGAGCAGCCTATCAAGGTGACTGAGTGGCAGCAGACATAC
ACCTACGACTCGGGTATCCACTCGGGCGCCAACACCTGCGTGCCCTCCGTCAGCAGCAAG
GGCATCATGGAGGAGGATGAGGCCTGCGGGCGCCAGTACACGCTCAAGAAAACCACCACT
TACACCCAGGGGGTGCCCCCCAGCCAAGGTGATCTGGAGTACCAGATGTCCACAACAGCC
AGGGCCAAACGGGTGCGGGAGGCCATGTGCCCTGGTGTGTCAGGCGAGGACAGCTCGCTT
CTGCTGGCCACCCAGGTGGAGGGGCAGGCCACCAACCTGCAGCGACTGGCCGAGCCGTCC
CAGCTGCTCAAGTCGGCCATTGTGCATCTCATCAACTACCAGGACGATGCCGAGCTGGCC
ACTCGCGCCCTGCCCGAGCTCACCAAACTGCTCAACGACGAGGACCCGGTGGTGGTGACC
AAGGCGGCCATGATTGTGAACCAGCTGTCGAAGAAGGAGGCGTCGCGGCGGGCCCTGATG
GGCTCGCCCCAGCTGGTGGCCGCTGTCGTGCGTACCATGCAGAATACCAGCGACCTGGAC
ACAGCCCGCTGCACCACCAGCATCCTGCACAACCTCTCCCACCACCGGGAGGGGCTGCTC
GCCATCTTCAAGTCGGGTGGCATCCCTGCTCTGGTCCGCATGCTCAGCTCCCCTGTGGAG
TCGGTCCTGTTCTATGCCATCACCACGCTGCACAACCTGCTCCTGTACCAGGAGGGCGCC
AAGATGGCCGTGCGCCTGGCCGACGGGCTGCAAAAGATGGTGCCCCTGCTCAACAAGAAC
AACCCCAAGTTCCTGGCCATCACCACCGACTGCCTGCAGCTCCTGGCCTACGGCAACCAG
GAGAGCAAGCTGATCATCCTGGCCAATGGTGGGCCCCAGGCCCTCGTGCAGATCATGCGT
AACTACAGTTATGAAAAGCTGCTCTGGACCACCAGTCGTGTGCTCAAGGTGCTATCCGTG
TGTCCCAGCAATAAGCCTGCCATTGTGGAGGCTGGTGGGATGCAGGCCCTGGGCAAGCAC
CTGACCAGCAACAGCCCCCGCCTGGTGCAGAACTGCCTGTGGACCCTGCGCAACCTCTCA
GATGTGGCCACCAAGCAGGAGGGCCTGGAGAGTGTGCTGAAGATTCTGGTGAATCAGCTG
AGTGTGGATGACGTCAACGTCCTCACCTGTGCCACGGGCACACTCTCCAACCTGACATGC
AACAACAGCAAGAACAAGACGCTGGTGACACAGAACAGCGGTGTGGAGGCTCTCATCCAT
GCCATCCTGCGTGCTGGTGACAAGGACGACATCACGGAGCCTGCCGTCTGCGCTCTGCGC
CACCTCACTAGCCGCCACCCTGAGGCCGAGATGGCCCAGAACTCTGTGCGTCTCAACTAT
GGCATCCCAGCCATCGTGAAGCTGCTCAACCAGCCCAACCAGTGGCCACTGGTCAAGGCA
ACCATCGGCTTGATCAGGAATCTGGCCCTGTGCCCAGCCAACCATGCCCCGCTGCAGGAG
GCAGCGGTCATCCCCCGCCTCGTCCAACTGCTGGTGAAGGCCCACCAGGATGCCCAGCGC
CACGTAGCTGCAGGCACACAGCAGCCCTACACGGATGGTGTGAGGATGGAGGAGATTGTG
GAGGGCTGCACCGGAGCACTGCACATCCTCGCCCGGGACCCCATGAACCGCATGGAGATC
TTCCGGCTCAACACCATTCCCCTGTTTGTGCAGCTCCTGTACTCGTCGGTGGAGAACATC
CAGCGCGTGGCTGCCGGGGTGCTGTGTGAGCTGGCCCAGGACAAGGAGGCGGCCGACGCC
ATTGATGCAGAGGGGGCCTCGGCCCCACTCATGGAGTTGCTGCACTCCCGCAACGAGGGC
ACTGCCACCTACGCTGCTGCCGTCCTGTTCCGCATCTCCGAGGACAAGAACCCAGACTAC
CGGAAGCGCGTGTCCGTGGAGCTCACCAACTCCCTCTTCAAGCATGACCCGGCTGCCTGG
GAGGCTGCCCAGAGCATGATTCCCATCAATGAGCCCTATGGAGATGACATGGATGCCACC
TACCGCCCCATGTACTCCAGCGATGTGCCCCTTGACCCGCTGGAGATGCACATGGACATG
GATGGAGACTACCCCATCGACACCTACAGCGACGGCCTCAGGCCCCCGTACCCCACTGCA
GACCACATGCTGGCCTAG
Chromosome Location
17
Locus
17q21.2
External Identifiers
ResourceLink
UniProtKB IDP14923
UniProtKB Entry NamePLAK_HUMAN
HGNC IDHGNC:6207
General References
  1. Franke WW, Goldschmidt MD, Zimbelmann R, Mueller HM, Schiller DL, Cowin P: Molecular cloning and amino acid sequence of human plakoglobin, the common junctional plaque protein. Proc Natl Acad Sci U S A. 1989 Jun;86(11):4027-31. [PubMed:2726765]
  2. Whittock NV, Eady RA, McGrath JA: Genomic organization and amplification of the human plakoglobin gene (JUP). Exp Dermatol. 2000 Oct;9(5):323-6. [PubMed:11016852]
  3. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. McKoy G, Protonotarios N, Crosby A, Tsatsopoulou A, Anastasakis A, Coonar A, Norman M, Baboonian C, Jeffery S, McKenna WJ: Identification of a deletion in plakoglobin in arrhythmogenic right ventricular cardiomyopathy with palmoplantar keratoderma and woolly hair (Naxos disease). Lancet. 2000 Jun 17;355(9221):2119-24. [PubMed:10902626]
  6. Butz S, Kemler R: Distinct cadherin-catenin complexes in Ca(2+)-dependent cell-cell adhesion. FEBS Lett. 1994 Nov 28;355(2):195-200. [PubMed:7982500]
  7. Witcher LL, Collins R, Puttagunta S, Mechanic SE, Munson M, Gumbiner B, Cowin P: Desmosomal cadherin binding domains of plakoglobin. J Biol Chem. 1996 May 3;271(18):10904-9. [PubMed:8631907]
  8. Yamamoto M, Bharti A, Li Y, Kufe D: Interaction of the DF3/MUC1 breast carcinoma-associated antigen and beta-catenin in cell adhesion. J Biol Chem. 1997 May 9;272(19):12492-4. [PubMed:9139698]
  9. Nieset JE, Redfield AR, Jin F, Knudsen KA, Johnson KR, Wheelock MJ: Characterization of the interactions of alpha-catenin with alpha-actinin and beta-catenin/plakoglobin. J Cell Sci. 1997 Apr;110 ( Pt 8):1013-22. [PubMed:9152027]
  10. Holsinger LJ, Ward K, Duffield B, Zachwieja J, Jallal B: The transmembrane receptor protein tyrosine phosphatase DEP1 interacts with p120(ctn). Oncogene. 2002 Oct 10;21(46):7067-76. [PubMed:12370829]
  11. Hatsell S, Medina L, Merola J, Haltiwanger R, Cowin P: Plakoglobin is O-glycosylated close to the N-terminal destruction box. J Biol Chem. 2003 Sep 26;278(39):37745-52. Epub 2003 Jul 7. [PubMed:12847106]
  12. Miravet S, Piedra J, Castano J, Raurell I, Franci C, Dunach M, Garcia de Herreros A: Tyrosine phosphorylation of plakoglobin causes contrary effects on its association with desmosomes and adherens junction components and modulates beta-catenin-mediated transcription. Mol Cell Biol. 2003 Oct;23(20):7391-402. [PubMed:14517306]
  13. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983]
  14. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  15. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  16. Gehmlich K, Syrris P, Peskett E, Evans A, Ehler E, Asimaki A, Anastasakis A, Tsatsopoulou A, Vouliotis AI, Stefanadis C, Saffitz JE, Protonotarios N, McKenna WJ: Mechanistic insights into arrhythmogenic right ventricular cardiomyopathy caused by desmocollin-2 mutations. Cardiovasc Res. 2011 Apr 1;90(1):77-87. doi: 10.1093/cvr/cvq353. Epub 2010 Nov 9. [PubMed:21062920]
  17. Kirchner F, Schuetz A, Boldt LH, Martens K, Dittmar G, Haverkamp W, Thierfelder L, Heinemann U, Gerull B: Molecular insights into arrhythmogenic right ventricular cardiomyopathy caused by plakophilin-2 missense mutations. Circ Cardiovasc Genet. 2012 Aug 1;5(4):400-11. doi: 10.1161/CIRCGENETICS.111.961854. Epub 2012 Jul 9. [PubMed:22781308]
  18. Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C: Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-alpha-acetylation features. Mol Cell Proteomics. 2012 Jun;11(6):M111.015131. doi: 10.1074/mcp.M111.015131. Epub 2012 Jan 5. [PubMed:22223895]
  19. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  20. Choi HJ, Gross JC, Pokutta S, Weis WI: Interactions of plakoglobin and beta-catenin with desmosomal cadherins: basis of selective exclusion of alpha- and beta-catenin from desmosomes. J Biol Chem. 2009 Nov 13;284(46):31776-88. doi: 10.1074/jbc.M109.047928. Epub 2009 Sep 16. [PubMed:19759396]
  21. Asimaki A, Syrris P, Wichter T, Matthias P, Saffitz JE, McKenna WJ: A novel dominant mutation in plakoglobin causes arrhythmogenic right ventricular cardiomyopathy. Am J Hum Genet. 2007 Nov;81(5):964-73. Epub 2007 Sep 28. [PubMed:17924338]
  22. den Haan AD, Tan BY, Zikusoka MN, Llado LI, Jain R, Daly A, Tichnell C, James C, Amat-Alarcon N, Abraham T, Russell SD, Bluemke DA, Calkins H, Dalal D, Judge DP: Comprehensive desmosome mutation analysis in north americans with arrhythmogenic right ventricular dysplasia/cardiomyopathy. Circ Cardiovasc Genet. 2009 Oct;2(5):428-35. doi: 10.1161/CIRCGENETICS.109.858217. Epub 2009 Jun 3. [PubMed:20031617]
  23. Barahona-Dussault C, Benito B, Campuzano O, Iglesias A, Leung TL, Robb L, Talajic M, Brugada R: Role of genetic testing in arrhythmogenic right ventricular cardiomyopathy/dysplasia. Clin Genet. 2010 Jan;77(1):37-48. doi: 10.1111/j.1399-0004.2009.01282.x. Epub 2009 Oct 15. [PubMed:19863551]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails