ATP-dependent DNA helicase RecQ

Details

Name
ATP-dependent DNA helicase RecQ
Synonyms
  • 3.6.4.12
Gene Name
recQ
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0003160|ATP-dependent DNA helicase RecQ
MAQAEVLNLESGAKQVLQETFGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIP
ALLLNGLTVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQLEVMTGCRTGQIRLLY
IAPERLMLDNFLEHLAHWNPVLLAVDEAHCISQWGHDFRPEYAALGQLRQRFPTLPFMAL
TATADDTTRQDIVRLLGLNDPLIQISSFDRPNIRYMLMEKFKPLDQLMRYVQEQRGKSGI
IYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRADVQEKFQRDDLQIVVATVAFGMGI
NKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPQGQL
QDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQEPCGNCDICLDPPKQYDGSTDAQIAL
STIGRVNQRFGMGYVVEVIRGANNQRIRDYGHDKLKVYGMGRDKSHEHWVSVIRQLIHLG
LVTQNIAQHSALQLTEAARPVLRGESSLQLAVPRIVALKPKAMQKSFGGNYDRKLFAKLR
KLRKSIADESNVPPYVVFNDATLIEMAEQMPITASEMLSVNGVGMRKLERFGKPFMALIR
AHVDGDDEE
Number of residues
609
Molecular Weight
68362.98
Theoretical pI
7.32
GO Classification
Functions
ATP binding / ATP-dependent 3'-5' DNA helicase activity / ATP-dependent DNA helicase activity / ATPase activity / DNA binding / DNA-dependent ATPase activity / single-stranded DNA-dependent ATP-dependent DNA helicase activity / transition metal ion binding / zinc ion binding
Processes
cellular response to DNA damage stimulus / DNA duplex unwinding / DNA recombination / DNA repair / DNA replication / SOS response
Components
bacterial nucleoid / cytoplasm / replisome / single-stranded DNA-dependent ATP-dependent DNA helicase complex
General Function
Zinc ion binding
Specific Function
Involved in the RecF recombination pathway; its gene expression is under the regulation of the SOS system. It is a DNA helicase.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0020550|ATP-dependent DNA helicase RecQ (recQ)
GTGGCGCAGGCGGAAGTGTTGAATCTGGAGTCCGGAGCTAAACAGGTTTTACAAGAAACC
TTTGGCTACCAACAGTTTCGCCCCGGCCAGGAAGAAATTATCGACACTGTGCTTTCCGGC
CGCGATTGCCTCGTCGTCATGCCCACTGGTGGCGGAAAATCCCTTTGCTATCAAATCCCT
GCCTTATTGCTAAACGGCCTTACCGTGGTTGTTTCACCGCTGATTTCGTTGATGAAAGAT
CAGGTGGATCAACTGCAAGCCAACGGCGTGGCGGCGGCGTGCCTTAACTCGACGCAAACC
CGCGAACAGCAACTTGAAGTGATGACAGGCTGCCGCACCGGGCAAATTCGTCTGCTTTAT
ATCGCCCCGGAACGCCTGATGCTGGATAACTTTCTTGAGCATCTGGCGCACTGGAATCCG
GTGTTATTAGCCGTTGATGAAGCGCACTGTATCTCCCAATGGGGCCACGATTTCCGCCCG
GAATATGCCGCGCTCGGTCAGTTGCGCCAGCGGTTCCCGACGCTGCCGTTTATGGCGCTG
ACCGCCACAGCCGACGACACCACGCGCCAGGATATCGTGCGCCTGCTGGGGCTGAACGAT
CCGCTGATTCAAATCAGCAGTTTTGACCGTCCGAATATTCGCTACATGCTGATGGAGAAG
TTCAAACCGCTCGATCAGTTGATGCGCTACGTGCAGGAACAGCGCGGTAAGTCAGGCATT
ATCTACTGCAACAGCCGCGCGAAAGTAGAAGACACCGCTGCGCGCCTGCAAAGCAAGGGA
ATTAGCGCGGCGGCCTATCATGCCGGGCTGGAAAATAATGTTCGCGCCGATGTGCAGGAA
AAATTCCAGCGCGATGACCTGCAAATTGTGGTGGCGACGGTGGCGTTCGGCATGGGCATC
AATAAACCAAACGTTCGCTTCGTGGTCCACTTTGATATTCCGCGCAATATCGAATCCTAT
TATCAGGAAACCGGACGCGCCGGGCGTGATGGCCTGCCCGCGGAAGCGATGCTGTTTTAC
GATCCGGCTGATATGGCGTGGCTGCGCCGTTGTCTGGAAGAGAAGCCGCAGGGGCAGTTG
CAGGATATCGAGCGCCACAAACTCAATGCGATGGGCGCGTTTGCCGAAGCGCAAACTTGC
CGTCGTCTGGTATTGCTGAACTATTTTGGCGAAGGGCGTCAGGAGCCGTGCGGGAACTGC
GATATCTGCCTCGATCCGCCGAAACAGTACGACGGTTCAACCGATGCTCAGATTGCCCTT
TCCACCATTGGTCGTGTGAATCAGCGGTTTGGGATGGGTTATGTGGTGGAAGTGATTCGT
GGTGCTAATAACCAGCGTATCCGCGACTATGGTCATGACAAACTGAAAGTCTATGGCATG
GGCCGTGATAAAAGCCATGAACATTGGGTGAGCGTGATCCGCCAGCTGATTCACCTCGGC
CTGGTGACGCAAAATATTGCCCAGCATTCTGCCCTACAACTGACAGAGGCCGCGCGCCCG
GTGCTGCGCGGCGAATCCTCTTTGCAACTTGCCGTGCCGCGTATCGTGGCGCTCAAACCG
AAAGCGATGCAGAAATCGTTCGGCGGCAACTATGATCGCAAACTGTTCGCCAAATTACGC
AAACTGCGTAAATCGATAGCCGATGAAAGTAATGTCCCGCCGTACGTGGTGTTTAACGAC
GCAACCTTGATTGAGATGGCTGAACAGATGCCGATCACCGCCAGCGAAATGCTCAGCGTT
AACGGCGTTGGGATGCGCAAGCTGGAACGCTTTGGCAAACCGTTTATGGCGCTGATTCGT
GCGCATGTTGATGGCGATGACGAAGAGTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP15043
UniProtKB Entry NameRECQ_ECOLI
GenBank Protein ID147559
GenBank Gene IDM30198
General References
  1. Irino N, Nakayama K, Nakayama H: The recQ gene of Escherichia coli K12: primary structure and evidence for SOS regulation. Mol Gen Genet. 1986 Nov;205(2):298-304. [PubMed:3027506]
  2. Daniels DL, Plunkett G 3rd, Burland V, Blattner FR: Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes. Science. 1992 Aug 7;257(5071):771-8. [PubMed:1379743]
  3. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [PubMed:9278503]
  4. Riley M, Abe T, Arnaud MB, Berlyn MK, Blattner FR, Chaudhuri RR, Glasner JD, Horiuchi T, Keseler IM, Kosuge T, Mori H, Perna NT, Plunkett G 3rd, Rudd KE, Serres MH, Thomas GH, Thomson NR, Wishart D, Wanner BL: Escherichia coli K-12: a cooperatively developed annotation snapshot--2005. Nucleic Acids Res. 2006 Jan 5;34(1):1-9. Print 2006. [PubMed:16397293]
  5. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [PubMed:16738553]
  6. Umezu K, Nakayama K, Nakayama H: Escherichia coli RecQ protein is a DNA helicase. Proc Natl Acad Sci U S A. 1990 Jul;87(14):5363-7. [PubMed:2164680]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02930Adenosine 5'-[gamma-thio]triphosphateexperimentalunknownDetails