Shikimate dehydrogenase (NADP(+))

Details

Name
Shikimate dehydrogenase (NADP(+))
Synonyms
  • 1.1.1.25
  • SD
Gene Name
aroE
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0011385|Shikimate dehydrogenase (NADP(+))
METYAVFGNPIAHSKSPFIHQQFAQQLNIEHPYGRVLAPINDFINTLNAFFSAGGKGANV
TVPFKEEAFARADELTERAALAGAVNTLMRLEDGRLLGDNTDGVGLLSDLERLSFIRPGL
RILLIGAGGASRGVLLPLLSLDCAVTITNRTVSRAEELAKLFAHTGSIQALSMDELEGHE
FDLIINATSSGISGDIPAIPSSLIHPGIYCYDMFYQKGKTPFLAWCEQRGSKRNADGLGM
LVAQAAHAFLLWHGVLPDVEPVIKQLQEELSA
Number of residues
272
Molecular Weight
29413.305
Theoretical pI
5.31
GO Classification
Functions
NADP binding / nucleotide binding / shikimate 3-dehydrogenase (NADP+) activity
Processes
aromatic amino acid family biosynthetic process / chorismate biosynthetic process / shikimate metabolic process
Components
cytosol
General Function
Shikimate 3-dehydrogenase (nadp+) activity
Specific Function
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). It displays no activity in the presence of NAD.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0011386|Shikimate dehydrogenase (NADP(+)) (aroE)
ATGGAAACCTATGCTGTTTTTGGTAATCCGATAGCCCACAGCAAATCGCCATTCATTCAT
CAGCAATTTGCTCAGCAACTGAATATTGAACATCCCTATGGGCGCGTGTTGGCACCCATC
AATGATTTCATCAACACACTGAACGCTTTCTTTAGTGCTGGTGGTAAAGGTGCGAATGTG
ACGGTGCCTTTTAAAGAAGAGGCTTTTGCCAGAGCGGATGAGCTTACTGAACGGGCAGCG
TTGGCTGGTGCTGTTAATACCCTCATGCGGTTAGAAGATGGACGCCTGCTGGGTGACAAT
ACCGATGGTGTAGGCTTGTTAAGCGATCTGGAACGTCTGTCTTTTATCCGCCCTGGTTTA
CGTATTCTGCTTATCGGCGCTGGTGGAGCATCTCGCGGCGTACTACTGCCACTCCTTTCC
CTGGACTGTGCGGTGACAATAACTAATCGGACGGTATCCCGCGCGGAAGAGTTGGCTAAA
TTGTTTGCGCACACTGGCAGTATTCAGGCGTTGAGTATGGACGAACTGGAAGGTCATGAG
TTTGATCTCATTATTAATGCAACATCCAGTGGCATCAGTGGTGATATTCCGGCGATCCCG
TCATCGCTCATTCATCCAGGCATTTATTGCTATGACATGTTCTATCAGAAAGGAAAAACT
CCTTTTCTGGCATGGTGTGAGCAGCGAGGCTCAAAGCGTAATGCTGATGGTTTAGGAATG
CTGGTGGCACAGGCGGCTCATGCCTTTCTTCTCTGGCACGGTGTTCTGCCTGACGTAGAA
CCAGTTATAAAGCAATTGCAGGAGGAATTGTCCGCGTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP15770
UniProtKB Entry NameAROE_ECOLI
GenBank Protein ID40978
GenBank Gene IDY00710
General References
  1. Anton IA, Coggins JR: Sequencing and overexpression of the Escherichia coli aroE gene encoding shikimate dehydrogenase. Biochem J. 1988 Jan 15;249(2):319-26. [PubMed:3277621]
  2. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [PubMed:9278503]
  3. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [PubMed:16738553]
  4. Chaudhuri S, Coggins JR: The purification of shikimate dehydrogenase from Escherichia coli. Biochem J. 1985 Feb 15;226(1):217-23. [PubMed:3883995]
  5. Maclean J, Campbell SA, Pollock K, Chackrewarthy S, Coggins JR, Lapthorn AJ: Crystallization and preliminary X-ray analysis of shikimate dehydrogenase from Escherichia coli. Acta Crystallogr D Biol Crystallogr. 2000 Apr;56(Pt 4):512-5. [PubMed:10739937]
  6. Michel G, Roszak AW, Sauve V, Maclean J, Matte A, Coggins JR, Cygler M, Lapthorn AJ: Structures of shikimate dehydrogenase AroE and its Paralog YdiB. A common structural framework for different activities. J Biol Chem. 2003 May 23;278(21):19463-72. Epub 2003 Mar 12. [PubMed:12637497]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03461Nicotinamide adenine dinucleotide phosphateexperimentalunknownDetails
DB044471,4-DithiothreitolexperimentalunknownDetails