RNA-directed RNA polymerase catalytic subunit

Details

Name
RNA-directed RNA polymerase catalytic subunit
Synonyms
  • 2.7.7.48
  • PB1
  • Polymerase basic protein 1
  • RNA-directed RNA polymerase subunit P1
Gene Name
PB1
Organism
Influenza A virus (strain A/Beijing/11/1956 H1N1)
Amino acid sequence
>lcl|BSEQ0010060|RNA-directed RNA polymerase catalytic subunit
MDVNPTLLFLKVPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYSERGRWTKNTE
TGAPQLNPIDGPLPEDNEPSGYAQTDCVLEAMAFLEESHPGIFENSCIETMEVVQQTRVD
KLTQGRQTYDWTLNRNQPAATALANTIEVFRSNGLMANESGRLIDFLKDVMESMDKEEIE
ITTHFQRKRRVRDNVTKKMVTQRTIGKKKQRLNKRSYLIRALTLNTMTKDAERGKLKRRA
IATPGMQIRGFVYFVETLARSICEKLEQSGLPVGGNEKKAKLANVVRKMMTNSQDTEISF
TITGDNTKWNENQNPRMFLAVITYITRNQPEWFRNILSIAPIMFSNKMARLGKGYMFESK
SMKLRTQISAEMLANIDLKYFNDSTRKKIEKIRPLLIDGTASLSPGMMMGMFNMLSTVLG
VSILNLGQKRYTKTTYWWDGLQSSDDFALIVNAPNHAGIQAGVDRFYRTCKLLGINMSKK
KSYINRTGTFEFTSFFYRYGFVANFSMELPSFGVSGINESADMSIGVTVIKNNMINNDLG
PATAQMALQLFIKDYRYTYRCHRGDTQIQTRRSFEIKKLWEQTRSKAGLLVSDGGPNLYN
IRNLHTPEVCLKWELMDEDYQGRLCNPLNPFVSHKEIESVNNAVMMPAHGPAKNMEYDAV
ATTHSWVPKRNRSILNTSQRGILEDEQMYQRCCNLFERFFPSSSYRRPVGISSMVEAMVS
RARIDARIDFESGRIKKEDFTEIMKICSTIEELRRQK
Number of residues
757
Molecular Weight
86534.5
Theoretical pI
9.74
GO Classification
Functions
nucleotide binding / RNA-directed RNA polymerase activity
Processes
suppression by virus of host RNA polymerase II activity / transcription, DNA-templated / viral RNA genome replication / viral transcription
Components
host cell cytoplasm / host cell nucleus
General Function
Rna-directed rna polymerase activity
Specific Function
RNA-dependent RNA polymerase which is responsible for replication and transcription of virus RNA segments. The transcription of viral mRNAs occurs by a unique mechanism called cap-snatching. 5' methylated caps of cellular mRNAs are cleaved after 10-13 nucleotides by PA. In turn, these short capped RNAs are used as primers by PB1 for transcription of viral mRNAs. During virus replication, PB1 initiates RNA synthesis and copy vRNA into complementary RNA (cRNA) which in turn serves as a template for the production of more vRNAs.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Host nucleus
Gene sequence
>lcl|BSEQ0000560|2274 bp
ATGGATGTCAATCCGACCTTACTTTTCTTAAAAGTGCCAGCACAAAATGCTATAAGCACA
ACTTTCCCTTATACTGGAGACCCTCCTTACAGCCATGGGACAGGAACAGGGTACACCATG
GATACTGTCAACAGGACACATCAGTACTCAGAAAGGGGAAGATGGACAAAAAACACCGAA
ACTGGAGCACCACAGCTCAACCCAATTGATGGGCCACTACCAGAAGACAATGAACCAAGT
GGTTATGCCCAAACAGATTGTGTATTAGAAGCAATGGCTTTCCTTGAGGAATCCCATCCT
GGTATTTTTGAAAACTCATGTATTGAAACGATGGAGGTTGTTCAGCAAACACGAGTGGAC
AAGCTGACACAAGGCCGACAGACCTATGACTGGACTCTGAATAGAAACCAGCCTGCTGCT
ACAGCATTGGCAAACACAATAGAAGTGTTCAGATCAAATGGCCTCATGGCAAATGAATCC
GGAAGGCTAATAGACTTTCTTAAAGATGTAATGGAGTCAATGGACAAAGAAGAAATAGAG
ATCACAACCCATTTTCAGAGAAAGAGACGGGTGAGGGACAATGTGACTAAGAAAATGGTG
ACACAAAGAACAATAGGCAAAAAGAAACAGAGATTAAACAAAAGGAGTTATCTAATTAGG
GCATTGACCCTGAACACAATGACCAAAGATGCTGAGAGAGGGAAACTAAAACGAAGAGCA
ATTGCAACCCCAGGGATGCAAATAAGGGGGTTTGTATACTTTGTTGAGACACTGGCAAGA
AGTATATGTGAAAAACTTGAACAATCAGGACTGCCAGTTGGAGGAAATGAAAAGAAAGCA
AAGTTGGCAAATGTTGTAAGGAAGATGATGACCAATTCTCAGGACACTGAAATTTCTTTC
ACCATCACTGGAGACAACACCAAATGGAACGAAAATCAAAACCCTAGAATGTTTTTGGCC
GTGATCACATATATAACCAGAAATCAGCCCGAATGGTTCAGAAATATTCTAAGTATTGCT
CCAATAATGTTCTCAAACAAAATGGCGAGACTAGGTAAGGGTTACATGTTTGAGAGCAAG
AGTATGAAACTTAGAACTCAAATATCTGCAGAAATGCTAGCAAACATCGATTTGAAGTAT
TTCAATGATTCAACAAGAAAGAAAATTGAAAAAATCCGGCCGCTCTTAATAGATGGGACT
GCATCACTGAGCCCTGGAATGATGATGGGCATGTTCAATATGTTAAGCACTGTATTGGGC
GTTTCCATCCTGAATCTTGGACAAAAGAGATACACAAAGACTACTTACTGGTGGGATGGT
CTTCAATCATCTGATGATTTTGCTCTGATTGTGAATGCACCCAATCATGCAGGAATTCAG
GCTGGAGTTGACAGGTTTTATCGAACTTGTAAGCTGCTCGGAATCAATATGAGTAAGAAA
AAGTCTTACATAAACAGAACAGGTACATTTGAATTCACTAGCTTTTTCTATCGTTATGGG
TTTGTTGCCAATTTCAGCATGGAGCTTCCCAGTTTTGGGGTGTCTGGGATCAACGAGTCT
GCAGATATGAGTATTGGGGTCACTGTCATCAAAAACAATATGATAAACAATGATCTTGGT
CCAGCAACCGCTCAAATGGCCCTTCAGTTATTCATCAAAGATTACAGGTACACGTATCGG
TGCCACAGAGGTGACACACAAATACAAACCCGAAGATCATTTGAAATAAAGAAACTGTGG
GAGCAAACCCGTTCCAAAGCTGGGCTGCTGGTCTCCGATGGAGGTCCTAACTTATATAAC
ATTAGAAATCTCCACACCCCTGAAGTCTGTTTGAAATGGGAATTGATGGATGAGGATTAC
CAGGGGCGTTTATGCAACCCATTGAACCCATTTGTCAGTCATAAAGAGATTGAATCAGTG
AACAATGCAGTGATGATGCCGGCACATGGTCCAGCCAAAAACATGGAGTATGATGCTGTA
GCAACAACACACTCCTGGGTCCCCAAAAGAAATCGATCCATCTTGAATACTAGTCAAAGG
GGAATACTTGAAGATGAACAAATGTATCAAAGGTGCTGCAATTTATTTGAAAGGTTCTTC
CCCAGCAGTTCATACAGAAGGCCAGTCGGAATATCCAGTATGGTGGAGGCTATGGTTTCC
AGAGCCCGAATTGATGCACGGATTGATTTCGAATCTGGAAGGATAAAGAAAGAGGATTTC
ACTGAGATCATGAAGATCTGTTCCACCATTGAAGAACTCAGACGGCAAAAATAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP16502
UniProtKB Entry NameRDRP_I56A0
GenBank Protein ID324960
GenBank Gene IDM25932
General References
  1. Kawaoka Y, Krauss S, Webster RG: Avian-to-human transmission of the PB1 gene of influenza A viruses in the 1957 and 1968 pandemics. J Virol. 1989 Nov;63(11):4603-8. [PubMed:2795713]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00811RibavirinapprovedunknowninhibitorDetails
DB06408TaribavirininvestigationalunknownDetails