Neuroendocrine convertase 2

Details

Name
Neuroendocrine convertase 2
Synonyms
  • 3.4.21.94
  • KEX2-like endoprotease 2
  • NEC 2
  • NEC2
  • PC2
  • Prohormone convertase 2
  • Proprotein convertase 2
Gene Name
PCSK2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0004166|Neuroendocrine convertase 2
MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDKARQVAAEHGFGVRKL
PFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILNKN
Number of residues
638
Molecular Weight
70564.735
Theoretical pI
6.47
GO Classification
Functions
serine-type endopeptidase activity
Processes
cellular protein metabolic process / enkephalin processing / insulin processing / islet amyloid polypeptide processing / nervous system development / protein autoprocessing / proteolysis
Components
dendrite / extracellular space / membrane / perikaryon / secretory granule lumen / transport vesicle
General Function
Serine-type endopeptidase activity
Specific Function
Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Responsible for the release of glucagon from proglucagon in pancreatic A cells.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic vesicle
Gene sequence
>lcl|BSEQ0011539|Neuroendocrine convertase 2 (PCSK2)
ATGGTTTTTGCATCTGCTGAGCGACCGGTCTTCACGAATCATTTTCTTGTGGAGTTGCAT
AAAGGGGGAGAGGACAAAGCTCGCCAAGTTGCAGCAGAACACGGCTTTGGAGTCCGAAAG
CTTCCCTTTGCTGAAGGTCTGTACCACTTTTATCACAATGGCCTTGCAAAGGCCAAGAGA
AGACGCAGCCTACACCACAAGCAGCAGCTGGAGAGAGACCCCAGGGTAAAGATGGCTTTG
CAGCAGGAAGGATTTGACCGAAAAAAGCGAGGTTACAGAGACATCAATGAGATCGACATC
AACATGAACGATCCTCTTTTTACAAAGCAGTGGTATCTGATCAATACTGGGCAAGCTGAT
GGCACTCCTGGCCTTGATTTGAATGTGGCTGAAGCCTGGGAGCTGGGATACACAGGGAAA
GGTGTTACCATTGGAATTATGGATGATGGGATTGACTATCTCCACCCGGACCTGGCCTCC
AACTATAATGCCGAAGCAAGTTACGACTTCAGCAGCAACGACCCCTATCCTTACCCTCGG
TACACAGATGACTGGTTTAACAGCCACGGGACCCGATGTGCAGGAGAAGTTTCTGCTGCC
GCCAACAACAATATCTGTGGAGTTGGAGTAGCATACAACTCCAAGGTTGCAGGCATCCGG
ATGCTGGACCAGCCATTCATGACAGACATCATCGAGGCCTCCTCCATCAGTCATATGCCA
CAGCTGATTGACATCTACAGCGCCAGCTGGGGCCCCACAGACAACGGCAAGACAGTGGAT
GGGCCCCGGGAGCTCACGCTGCAGGCCATGGCCGATGGCGTGAACAAGGGCCGCGGCGGC
AAAGGCAGCATCTACGTGTGGGCCTCCGGGGACGGCGGCAGCTATGACGACTGCAACTGC
GACGGCTACGCCTCCAGCATGTGGACCATCTCCATCAACTCAGCCATCAACGACGGCAGG
ACTGCCCTGTACGACGAGAGCTGCTCTTCCACCTTGGCTTCCACCTTCAGCAACGGGAGG
AAAAGGAACCCCGAGGCCGGTGTGGCAACCACAGATTTGTACGGCAACTGCACTCTGAGG
CATTCTGGGACATCTGCAGCTGCCCCCGAGGCAGCTGGTGTGTTTGCACTGGCTCTGGAG
GCTAACCTGGGTCTGACCTGGCGGGACATGCAGCATCTGACTGTGCTCACCTCCAAACGG
AACCAGCTTCACGACGAGGTCCATCAGTGGCGGCGCAATGGGGTCGGCCTGGAATTTAAT
CACCTCTTTGGCTACGGGGTCCTTGATGCAGGTGCCATGGTGAAAATGGCTAAAGACTGG
AAAACCGTGCCTGAGAGATTCCACTGTGTGGGAGGCTCCGTGCAGGACCCTGAGAAAATA
CCATCCACTGGCAAGTTGGTGCTGACACTCACAACCGACGCCTGTGAGGGGAAGGAAAAT
TTTGTCCGCTACCTGGAGCATGTCCAGGCTGTCATCACGGTCAACGCAACCAGAAGAGGA
GACCTGAACATCAACATGACTTCCCCTATGGGCACCAAGTCCATTTTGCTGAGCCGGCGT
CCAAGGGATGACGACTCCAAGGTGGGCTTTGACAAGTGGCCTTTCATGACCACTCACACG
TGGGGGGAAGACGCCCGAGGCACCTGGACCCTGGAGCTGGGATTTGTCGGCAGCGCCCCG
CAGAAGGGGGTGCTGAAGGAGTGGACCCTGATGCTGCATGGCACTCAGAGTGCCCCGTAC
ATCGACCAGGTGGTGCGGGATTACCAGTCCAAGTTGGCCATGTCCAAGAAAGAGGAGCTG
GAGGAAGAGCTGGACGAAGCCGTGGAGAGAAGCCTGAAAAGCATCCTTAACAAGAACTAG
Chromosome Location
20
Locus
20p11.2
External Identifiers
ResourceLink
UniProtKB IDP16519
UniProtKB Entry NameNEC2_HUMAN
GenBank Protein ID189652
GenBank Gene IDJ05252
GenAtlas IDPCSK2
HGNC IDHGNC:8744
General References
  1. Smeekens SP, Steiner DF: Identification of a human insulinoma cDNA encoding a novel mammalian protein structurally related to the yeast dibasic processing protease Kex2. J Biol Chem. 1990 Feb 25;265(6):2997-3000. [PubMed:2154467]
  2. Ohagi S, LaMendola J, LeBeau MM, Espinosa R 3rd, Takeda J, Smeekens SP, Chan SJ, Steiner DF: Identification and analysis of the gene encoding human PC2, a prohormone convertase expressed in neuroendocrine tissues. Proc Natl Acad Sci U S A. 1992 Jun 1;89(11):4977-81. [PubMed:1594602]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Ohagi S, Yoshida H, Nanjo K: [Analysis of the gene encoding human PC2, a prohormone processing enzyme]. Nihon Rinsho. 1994 Oct;52(10):2544-9. [PubMed:7983775]
  7. Rouille Y, Bianchi M, Irminger JC, Halban PA: Role of the prohormone convertase PC2 in the processing of proglucagon to glucagon. FEBS Lett. 1997 Aug 11;413(1):119-23. [PubMed:9287128]
  8. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00071Insulin porkapprovedunknownDetails
DB00030Insulin humanapproved, investigationalunknownactivatorDetails