Carboxypeptidase E

Details

Name
Carboxypeptidase E
Synonyms
  • 3.4.17.10
  • Carboxypeptidase H
  • CPE
  • CPH
  • Enkephalin convertase
  • Prohormone-processing carboxypeptidase
Gene Name
CPE
Organism
Humans
Amino acid sequence
>lcl|BSEQ0002234|Carboxypeptidase E
MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELR
EALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVG
RELLIFLAQYLCNEYQKGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRS
NAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNMKKIVDQNTKLAPETKAVIHWIMDIP
FVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPC
RKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWED
NKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYK
LTASAPGYLAITKKVAVPYSPAAGVDFELESFSERKEEEKEELMEWWKMMSETLNF
Number of residues
476
Molecular Weight
53150.185
Theoretical pI
4.78
GO Classification
Functions
carboxypeptidase activity / cell adhesion molecule binding / metallocarboxypeptidase activity / neurexin family protein binding / serine-type carboxypeptidase activity / zinc ion binding
Processes
cardiac left ventricle morphogenesis / cellular protein metabolic process / cellular protein modification process / insulin processing / metabolic process / neuropeptide signaling pathway / protein localization to membrane / Wnt signaling pathway
Components
extracellular exosome / extracellular space / Golgi apparatus / neuronal cell body / nucleus / plasma membrane / secretory granule / secretory granule membrane / synaptic membrane / transport vesicle membrane
General Function
Zinc ion binding
Specific Function
Removes residual C-terminal Arg or Lys remaining after initial endoprotease cleavage during prohormone processing. Processes proinsulin.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic vesicle
Gene sequence
>lcl|BSEQ0016324|Carboxypeptidase E (CPE)
ATGGCCGGGCGAGGGGGCAGCGCGCTGCTGGCTCTGTGCGGGGCACTGGCTGCCTGCGGG
TGGCTCCTGGGCGCCGAAGCCCAGGAGCCCGGGGCGCCCGCGGCGGGCATGAGGCGGCGC
CGGCGGCTGCAGCAAGAGGACGGCATCTCCTTCGAGTACCACCGCTACCCCGAGCTGCGC
GAGGCGCTCGTGTCCGTGTGGCTGCAGTGCACCGCCATCAGCAGGATTTACACGGTGGGG
CGCAGCTTCGAGGGCCGGGAGCTCCTGGTCATCGAGCTGTCCGACAACCCTGGCGTCCAT
GAGCCTGGTGAGCCTGAATTTAAATACATTGGGAATATGCATGGGAATGAGGCTGTTGGA
CGAGAACTGCTCATTTTCTTGGCCCAGTACCTATGCAACGAATACCAGAAGGGGAACGAG
ACAATTGTCAACCTGATCCACAGTACCCGCATTCACATCATGCCTTCCCTGAACCCAGAT
GGCTTTGAGAAGGCAGCGTCTCAGCCTGGTGAACTCAAGGACTGGTTTGTGGGTCGAAGC
AATGCCCAGGGAATAGATCTGAACCGGAACTTTCCAGACCTGGATAGGATAGTGTACGTG
AATGAGAAAGAAGGTGGTCCAAATAATCATCTGTTGAAAAATATGAAGAAAATTGTGGAT
CAAAACACAAAGCTTGCTCCTGAGACCAAGGCTGTCATTCATTGGATTATGGATATTCCT
TTTGTGCTTTCTGCCAATCTCCATGGAGGAGACCTTGTGGCCAATTATCCATATGATGAG
ACGCGGAGTGGTAGTGCTCACGAATACAGCTCCTCCCCAGATGACGCCATTTTCCAAAGC
TTGGCCCGGGCATACTCTTCTTTCAACCCGGCCATGTCTGACCCCAATCGGCCACCATGT
CGCAAGAATGATGATGACAGCAGCTTTGTAGATGGAACCACCAACGGTGGTGCTTGGTAC
AGCGTACCTGGAGGGATGCAAGACTTCAATTACCTTAGCAGCAACTGTTTTGAGATCACC
GTGGAGCTTAGCTGTGAGAAGTTCCCACCTGAAGAGACTCTGAAGACCTACTGGGAGGAT
AACAAAAACTCCCTCATTAGCTACCTTGAGCAGATACACCGAGGAGTTAAAGGATTTGTC
CGAGACCTTCAAGGTAACCCAATTGCGAATGCCACCATCTCCGTGGAAGGAATAGACCAC
GATGTTACATCCGCAAAGGATGGTGATTACTGGAGATTGCTTATACCTGGAAACTATAAA
CTTACAGCCTCAGCTCCAGGCTATCTGGCAATAACAAAGAAAGTGGCAGTTCCTTACAGC
CCTGCTGCTGGGGTTGATTTTGAACTGGAGTCATTTTCTGAAAGGAAAGAAGAGGAGAAG
GAAGAATTGATGGAATGGTGGAAAATGATGTCAGAAACTTTAAATTTTTAA
Chromosome Location
4
Locus
4q32.3
External Identifiers
ResourceLink
UniProtKB IDP16870
UniProtKB Entry NameCBPE_HUMAN
GenBank Protein ID29667
GenBank Gene IDX51405
GenAtlas IDCPE
HGNC IDHGNC:2303
General References
  1. Manser E, Fernandez D, Loo L, Goh PY, Monfries C, Hall C, Lim L: Human carboxypeptidase E. Isolation and characterization of the cDNA, sequence conservation, expression and processing in vitro. Biochem J. 1990 Apr 15;267(2):517-25. [PubMed:2334405]
  2. Utsunomiya N, Ohagi S, Sanke T, Tatsuta H, Hanabusa T, Nanjo K: Organization of the human carboxypeptidase E gene and molecular scanning for mutations in Japanese subjects with NIDDM or obesity. Diabetologia. 1998 Jun;41(6):701-5. [PubMed:9662053]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Lee TK, Murthy SR, Cawley NX, Dhanvantari S, Hewitt SM, Lou H, Lau T, Ma S, Huynh T, Wesley RA, Ng IO, Pacak K, Poon RT, Loh YP: An N-terminal truncated carboxypeptidase E splice isoform induces tumor growth and is a biomarker for predicting future metastasis in human cancers. J Clin Invest. 2011 Mar;121(3):880-92. doi: 10.1172/JCI40433. [PubMed:21285511]
  6. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00071Insulin PorkapprovedunknownDetails
DB14487Zinc acetateapproved, investigationalunknowninhibitorligandDetails
DB14533Zinc chlorideapproved, investigationalunknowninhibitorligandDetails
DB00030Insulin humanapproved, investigationalunknownmodulatorDetails