Interferon alpha/beta receptor 1

Details

Name
Interferon alpha/beta receptor 1
Synonyms
  • CRF2-1
  • Cytokine receptor class-II member 1
  • Cytokine receptor family 2 member 1
  • IFN-R-1
  • IFNAR
  • Type I interferon receptor 1
Gene Name
IFNAR1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001318|Interferon alpha/beta receptor 1
MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVT
FSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSF
TPFRKAQIGPPEVHLEAEDKAIVIHISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERI
ENIYSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSVQ
NQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQK
GIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTP
VIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSV
FSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDE
YFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSN
EDESESKTSEELQQDFV
Number of residues
557
Molecular Weight
63524.81
Theoretical pI
5.56
GO Classification
Functions
type I interferon receptor activity
Processes
cell surface receptor signaling pathway / cytokine-mediated signaling pathway / defense response to virus / JAK-STAT cascade / positive regulation of interferon-beta production / positive regulation of interferon-gamma production / positive regulation of interleukin-1 beta secretion / positive regulation of transcription, DNA-templated / regulation of peptidyl-tyrosine phosphorylation / regulation of type I interferon-mediated signaling pathway / response to virus / T cell activation / type I interferon biosynthetic process / type I interferon signaling pathway
Components
integral component of plasma membrane / intracellular / plasma membrane
General Function
Type i interferon receptor activity
Specific Function
Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta-subunits themselves. Can also transduce IFNB signals without the help of IFNAR2, and not activating the Jak-STAT pathway.
Pfam Domain Function
Transmembrane Regions
437-457
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0018987|Interferon alpha/beta receptor 1 (IFNAR1)
ATGATGGTCGTCCTCCTGGGCGCGACGACCCTAGTGCTCGTCGCCGTGGCGCCATGGGTG
TTGTCCGCAGCCGCAGGTGGAAAAAATCTAAAATCTCCTCAAAAAGTAGAGGTCGACATC
ATAGATGACAACTTTATCCTGAGGTGGAACAGGAGCGATGAGTCTGTCGGGAATGTGACT
TTTTCATTCGATTATCAAAAAACTGGGATGGATAATTGGATAAAATTGTCTGGGTGTCAG
AATATTACTAGTACCAAATGCAACTTTTCTTCACTCAAGCTGAATGTTTATGAAGAAATT
AAATTGCGTATAAGAGCAGAAAAAGAAAACACTTCTTCATGGTATGAGGTTGACTCATTT
ACACCATTTCGCAAAGCTCAGATTGGTCCTCCAGAAGTACATTTAGAAGCTGAAGATAAG
GCAATAGTGATACACATCTCTCCTGGAACAAAAGATAGTGTTATGTGGGCTTTGGATGGT
TTAAGCTTTACATATAGCTTAGTTATCTGGAAAAACTCTTCAGGTGTAGAAGAAAGGATT
GAAAATATTTATTCCAGACATAAAATTTATAAACTCTCACCAGAGACTACTTATTGTCTA
AAAGTTAAAGCAGCACTACTTACGTCATGGAAAATTGGTGTCTATAGTCCAGTACATTGT
ATAAAGACCACAGTTGAAAATGAACTACCTCCACCAGAAAATATAGAAGTCAGTGTCCAA
AATCAGAACTATGTTCTTAAATGGGATTATACATATGCAAACATGACCTTTCAAGTTCAG
TGGCTCCACGCCTTTTTAAAAAGGAATCCTGGAAACCATTTGTATAAATGGAAACAAATA
CCTGACTGTGAAAATGTCAAAACTACCCAGTGTGTCTTTCCTCAAAACGTTTTCCAAAAA
GGAATTTACCTTCTCCGCGTACAAGCATCTGATGGAAATAACACATCTTTTTGGTCTGAA
GAGATAAAGTTTGATACTGAAATACAAGCTTTCCTACTTCCTCCAGTCTTTAACATTAGA
TCCCTTAGTGATTCATTCCATATCTATATCGGTGCTCCAAAACAGTCTGGAAACACGCCT
GTGATCCAGGATTATCCACTGATTTATGAAATTATTTTTTGGGAAAACACTTCAAATGCT
GAGAGAAAAATTATCGAGAAAAAAACTGATGTTACAGTTCCTAATTTGAAACCACTGACT
GTATATTGTGTGAAAGCCAGAGCACACACCATGGATGAAAAGCTGAATAAAAGCAGTGTT
TTTAGTGACGCTGTATGTGAGAAAACAAAACCAGGAAATACCTCTAAAATTTGGCTTATA
GTTGGAATTTGTATTGCATTATTTGCTCTCCCGTTTGTCATTTATGCTGCGAAAGTCTTC
TTGAGATGCATCAATTATGTCTTCTTTCCATCACTTAAACCTTCTTCCAGTATAGATGAG
TATTTCTCTGAACAGCCATTGAAGAATCTTCTGCTTTCAACTTCTGAGGAACAAATCGAA
AAATGTTTCATAATTGAAAATATAAGCACAATTGCTACAGTAGAAGAAACTAATCAAACT
GATGAAGATCATAAAAAATACAGTTCCCAAACTAGCCAAGATTCAGGAAATTATTCTAAT
GAAGATGAAAGCGAAAGTAAAACAAGTGAAGAACTACAGCAGGACTTTGTATGA
Chromosome Location
21
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP17181
UniProtKB Entry NameINAR1_HUMAN
GenBank Protein ID306914
GenBank Gene IDJ03171
GenAtlas IDIFNAR1
HGNC IDHGNC:5432
General References
  1. Uze G, Lutfalla G, Gresser I: Genetic transfer of a functional human interferon alpha receptor into mouse cells: cloning and expression of its cDNA. Cell. 1990 Jan 26;60(2):225-34. [PubMed:2153461]
  2. Lutfalla G, Gardiner K, Proudhon D, Vielh E, Uze G: The structure of the human interferon alpha/beta receptor gene. J Biol Chem. 1992 Feb 5;267(4):2802-9. [PubMed:1370833]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Hattori M, Fujiyama A, Taylor TD, Watanabe H, Yada T, Park HS, Toyoda A, Ishii K, Totoki Y, Choi DK, Groner Y, Soeda E, Ohki M, Takagi T, Sakaki Y, Taudien S, Blechschmidt K, Polley A, Menzel U, Delabar J, Kumpf K, Lehmann R, Patterson D, Reichwald K, Rump A, Schillhabel M, Schudy A, Zimmermann W, Rosenthal A, Kudoh J, Schibuya K, Kawasaki K, Asakawa S, Shintani A, Sasaki T, Nagamine K, Mitsuyama S, Antonarakis SE, Minoshima S, Shimizu N, Nordsiek G, Hornischer K, Brant P, Scharfe M, Schon O, Desario A, Reichelt J, Kauer G, Blocker H, Ramser J, Beck A, Klages S, Hennig S, Riesselmann L, Dagand E, Haaf T, Wehrmeyer S, Borzym K, Gardiner K, Nizetic D, Francis F, Lehrach H, Reinhardt R, Yaspo ML: The DNA sequence of human chromosome 21. Nature. 2000 May 18;405(6784):311-9. [PubMed:10830953]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Abramovich C, Ratovitski E, Lundgren E, Revel M: Identification of mRNAs encoding two different soluble forms of the human interferon alpha-receptor. FEBS Lett. 1994 Feb 7;338(3):295-300. [PubMed:8307198]
  7. Colamonici O, Yan H, Domanski P, Handa R, Smalley D, Mullersman J, Witte M, Krishnan K, Krolewski J: Direct binding to and tyrosine phosphorylation of the alpha subunit of the type I interferon receptor by p135tyk2 tyrosine kinase. Mol Cell Biol. 1994 Dec;14(12):8133-42. [PubMed:7526154]
  8. Li X, Leung S, Kerr IM, Stark GR: Functional subdomains of STAT2 required for preassociation with the alpha interferon receptor and for signaling. Mol Cell Biol. 1997 Apr;17(4):2048-56. [PubMed:9121453]
  9. Russell-Harde D, Wagner TC, Perez HD, Croze E: Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation. Biochem Biophys Res Commun. 1999 Feb 16;255(2):539-44. [PubMed:10049744]
  10. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330]
  11. Claudinon J, Gonnord P, Beslard E, Marchetti M, Mitchell K, Boularan C, Johannes L, Eid P, Lamaze C: Palmitoylation of interferon-alpha (IFN-alpha) receptor subunit IFNAR1 is required for the activation of Stat1 and Stat2 by IFN-alpha. J Biol Chem. 2009 Sep 4;284(36):24328-40. doi: 10.1074/jbc.M109.021915. Epub 2009 Jun 26. [PubMed:19561067]
  12. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973]
  13. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332]
  14. Thomas C, Moraga I, Levin D, Krutzik PO, Podoplelova Y, Trejo A, Lee C, Yarden G, Vleck SE, Glenn JS, Nolan GP, Piehler J, Schreiber G, Garcia KC: Structural linkage between ligand discrimination and receptor activation by type I interferons. Cell. 2011 Aug 19;146(4):621-32. doi: 10.1016/j.cell.2011.06.048. [PubMed:21854986]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00018Interferon alfa-n3approved, investigationalyesagonistDetails
DB00022Peginterferon alfa-2bapprovedyesagonistDetails
DB00034Interferon Alfa-2a, Recombinantapproved, investigationalyesDetails
DB00069Interferon alfacon-1approved, investigationalyesbinderDetails
DB00008Peginterferon alfa-2aapproved, investigationalyesagonistDetails
DB00011Interferon alfa-n1approved, investigationalyesagonistDetails
DB00105Interferon alfa-2bapprovedyesbinderDetails
DB00068Interferon beta-1bapprovedyesagonistDetails
DB05258Interferon alfainvestigationalunknownDetails
DB05472omega interferoninvestigationalunknownDetails
DB00060Interferon beta-1aapproved, investigationalyesagonistDetails