Atrial natriuretic peptide receptor 3

Details

Name
Atrial natriuretic peptide receptor 3
Synonyms
  • ANP-C
  • ANPR-C
  • ANPRC
  • Atrial natriuretic peptide clearance receptor
  • Atrial natriuretic peptide receptor type C
  • C5orf23
  • NPR-C
  • NPRC
Gene Name
NPR3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0004764|Atrial natriuretic peptide receptor 3
MPSLLVLTFSPCVLLGWALLAGGTGGGGVGGGGGGAGIGGGRQEREALPPQKIEVLVLLP
QDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRV
AAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPA
YAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETK
DLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDG
SWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMFVEG
FHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIA
MTDVEAGTQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENRIVEHTNSSPCKSSGGLE
ESAVTGIVVGALLGAGLLMAFYFFRKKYRITIERRTQQEESNLGKHRELREDSIRSHFSV
A
Number of residues
541
Molecular Weight
59807.34
Theoretical pI
6.31
GO Classification
Functions
G-protein coupled peptide receptor activity / hormone binding / natriuretic peptide receptor activity / peptide hormone binding
Processes
adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway / cAMP biosynthetic process / cAMP-mediated signaling / negative regulation of adenylate cyclase activity / negative regulation of smooth muscle cell proliferation / osteoclast proliferation / pancreatic juice secretion / phosphatidylinositol-mediated signaling / phospholipase C-activating G-protein coupled receptor signaling pathway / positive regulation of nitric-oxide synthase activity / positive regulation of urine volume / regulation of blood pressure / regulation of osteoblast proliferation / skeletal system development
Components
extracellular exosome / integral component of plasma membrane / intracellular / plasma membrane
General Function
Peptide hormone binding
Specific Function
Receptor for the natriuretic peptide hormones, binding with similar affinities atrial natriuretic peptide NPPA/ANP, brain natriuretic peptide NPPB/BNP, and C-type natriuretic peptide NPPC/CNP. May function as a clearance receptor for NPPA, NPPB and NPPC, regulating their local concentrations and effects. May regulate diuresis, blood pressure and skeletal development. Does not have guanylate cyclase activity.
Pfam Domain Function
Transmembrane Regions
482-504
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0011737|Atrial natriuretic peptide receptor 3 (NPR3)
ATGCCGTCTCTGCTGGTGCTCACTTTCTCCCCGTGCGTACTACTCGGCTGGGCGTTGCTG
GCCGGCGGCACCGGTGGCGGTGGCGTTGGCGGCGGCGGCGGTGGCGCGGGCATAGGCGGC
GGACGCCAGGAGAGAGAGGCGCTGCCGCCACAGAAGATCGAGGTGCTGGTGTTACTGCCC
CAGGATGACTCGTACTTGTTTTCACTCACCCGGGTGCGGCCGGCCATCGAGTATGCTCTG
CGCAGCGTGGAGGGCAACGGGACTGGGAGGCGGCTTCTGCCGCCGGGCACTCGCTTCCAG
GTGGCTTACGAGGATTCAGACTGTGGGAACCGTGCGCTCTTCAGCTTGGTGGACCGCGTG
GCGGCGGCGCGGGGCGCCAAGCCAGACCTTATCCTGGGGCCAGTGTGCGAGTATGCAGCA
GCGCCAGTGGCCCGGCTTGCATCGCACTGGGACCTGCCCATGCTGTCGGCTGGGGCGCTG
GCCGCTGGCTTCCAGCACAAGGACTCTGAGTACTCGCACCTCACGCGCGTGGCGCCCGCC
TACGCCAAGATGGGCGAGATGATGCTCGCCCTGTTCCGCCACCACCACTGGAGCCGCGCT
GCACTGGTCTACAGCGACGACAAGCTGGAGCGGAACTGCTACTTCACCCTCGAGGGGGTC
CACGAGGTCTTCCAGGAGGAGGGTTTGCACACGTCCATCTACAGTTTCGACGAGACCAAA
GACTTGGATCTGGAAGACATCGTGCGCAATATCCAGGCCAGTGAGAGAGTGGTGATCATG
TGTGCGAGCAGTGACACCATCCGGAGCATCATGCTGGTGGCGCACAGGCATGGCATGACC
AGTGGAGACTACGCCTTCTTCAACATTGAGCTCTTCAACAGCTCTTCCTATGGAGATGGC
TCATGGAAGAGAGGAGACAAACACGACTTTGAAGCTAAGCAAGCATACTCGTCCCTCCAG
ACAGTCACTCTACTGAGGACAGTGAAACCTGAGTTTGAGAAGTTTTCCATGGAGGTGAAA
AGTTCAGTTGAGAAACAAGGGCTCAATATGGAGGATTACGTTAACATGTTTGTTGAAGGA
TTCCACGATGCCATCCTCCTCTACGTCTTGGCTCTACATGAAGTACTCAGAGCTGGTTAC
AGCAAAAAGGATGGAGGGAAAATTATACAGCAGACTTGGAACAGAACATTTGAAGGTATC
GCCGGGCAGGTGTCCATAGATGCCAACGGAGACCGATATGGGGATTTCTCTGTGATTGCC
ATGACTGATGTGGAGGCGGGCACCCAGGAGGTTATTGGTGATTATTTTGGAAAAGAAGGT
CGTTTTGAAATGCGGCCGAATGTCAAATATCCTTGGGGCCCTTTAAAACTGAGAATAGAT
GAAAACCGAATTGTAGAGCATACAAACAGCTCTCCCTGCAAATCATGTGGCCTAGAAGAA
TCGGCAGTGACAGGAATTGTCGTGGGGGCTTTACTAGGAGCTGGCTTGCTAATGGCCTTC
TACTTTTTCAGGAAGAAATACAGAATAACCATTGAGAGGCGAACCCAGCAAGAAGAAAGT
AACCTTGGAAAACATCGGGAATTACGGGAAGATTCCATCAGATCCCATTTTTCAGTAGCT
TAA
Chromosome Location
5
Locus
5p14-p13
External Identifiers
ResourceLink
UniProtKB IDP17342
UniProtKB Entry NameANPRC_HUMAN
GenBank Gene IDX52282
GenAtlas IDNPR3
HGNC IDHGNC:7945
General References
  1. Lowe DG, Camerato TR, Goeddel DV: cDNA sequence of the human atrial natriuretic peptide clearance receptor. Nucleic Acids Res. 1990 Jun 11;18(11):3412. [PubMed:2162522]
  2. Porter JG, Arfsten A, Fuller F, Miller JA, Gregory LC, Lewicki JA: Isolation and functional expression of the human atrial natriuretic peptide clearance receptor cDNA. Biochem Biophys Res Commun. 1990 Sep 14;171(2):796-803. [PubMed:2169733]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Stults JT, O'Connell KL, Garcia C, Wong S, Engel AM, Garbers DL, Lowe DG: The disulfide linkages and glycosylation sites of the human natriuretic peptide receptor-C homodimer. Biochemistry. 1994 Sep 20;33(37):11372-81. [PubMed:7727388]
  7. Bennett BD, Bennett GL, Vitangcol RV, Jewett JR, Burnier J, Henzel W, Lowe DG: Extracellular domain-IgG fusion proteins for three human natriuretic peptide receptors. Hormone pharmacology and application to solid phase screening of synthetic peptide antisera. J Biol Chem. 1991 Dec 5;266(34):23060-7. [PubMed:1660465]
  8. He Xl, Chow Dc, Martick MM, Garcia KC: Allosteric activation of a spring-loaded natriuretic peptide receptor dimer by hormone. Science. 2001 Aug 31;293(5535):1657-62. [PubMed:11533490]
  9. He XL, Dukkipati A, Garcia KC: Structural determinants of natriuretic peptide receptor specificity and degeneracy. J Mol Biol. 2006 Aug 25;361(4):698-714. Epub 2006 Jul 10. [PubMed:16870210]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04899Nesiritideapproved, investigationalunknownDetails