Alpha-2B adrenergic receptor

Details

Name
Alpha-2B adrenergic receptor
Synonyms
  • ADRA2L1
  • ADRA2RL1
  • Alpha-2 adrenergic receptor subtype C2
  • Alpha-2B adrenoceptor
  • Alpha-2B adrenoreceptor
  • Alpha-2BAR
Gene Name
ADRA2B
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010396|Alpha-2B adrenergic receptor
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQL
TREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLNP
VIYTIFNQDFRRAFRRILCRPWTQTAW
Number of residues
447
Molecular Weight
49565.8
Theoretical pI
8.52
GO Classification
Functions
alpha2-adrenergic receptor activity / epinephrine binding
Processes
activation of MAPK activity by adrenergic receptor signaling pathway / activation of protein kinase B activity / blood coagulation / cell-cell signaling / epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway / G-protein coupled receptor signaling pathway / negative regulation of epinephrine secretion / negative regulation of norepinephrine secretion / platelet activation / positive regulation of neuron differentiation / regulation of smooth muscle contraction / regulation of vasoconstriction
Components
integral component of plasma membrane / plasma membrane
General Function
Epinephrine binding
Specific Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. The rank order of potency for agonists of this receptor is clonidine > norepinephrine > epinephrine = oxymetazoline > dopamine > p-tyramine = phenylephrine > serotonin > p-synephrine / p-octopamine. For antagonists, the rank order is yohimbine > chlorpromazine > phentolamine > mianserine > spiperone > prazosin > alprenolol > propanolol > pindolol.
Pfam Domain Function
Transmembrane Regions
13-38 49-69 87-107 129-149 173-193 370-393 403-423
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010397|Alpha-2B adrenergic receptor (ADRA2B)
ATGGACCACCAGGACCCCTACTCCGTGCAGGCCACAGCGGCCATAGCGGCGGCCATCACC
TTCCTCATTCTCTTTACCATCTTCGGCAACGCTCTGGTCATCCTGGCTGTGTTGACCAGC
CGCTCGCTGCGCGCCCCTCAGAACCTGTTCCTGGTGTCGCTGGCCGCCGCCGACATCCTG
GTGGCCACGCTCATCATCCCTTTCTCGCTGGCCAACGAGCTGCTGGGCTACTGGTACTTC
CGGCGCACGTGGTGCGAGGTGTACCTGGCGCTCGACGTGCTCTTCTGCACCTCGTCCATC
GTGCACCTGTGCGCCATCAGCCTGGACCGCTACTGGGCCGTGAGCCGCGCGCTGGAGTAC
AACTCCAAGCGCACCCCGCGCCGCATCAAGTGCATCATCCTCACTGTGTGGCTCATCGCC
GCCGTCATCTCGCTGCCGCCCCTCATCTACAAGGGCGACCAGGGCCCCCAGCCGCGCGGG
CGCCCCCAGTGCAAGCTCAACCAGGAGGCCTGGTACATCCTGGCCTCCAGCATCGGATCT
TTCTTTGCTCCTTGCCTCATCATGATCCTTGTCTACCTGCGCATCTACCTGATCGCCAAA
CGCAGCAACCGCAGAGGTCCCAGGGCCAAGGGGGGGCCTGGGCAGGGTGAGTCCAAGCAG
CCCCGACCCGACCATGGTGGGGCTTTGGCCTCAGCCAAACTGCCAGCCCTGGCCTCTGTG
GCTTCTGCCAGAGAGGTCAACGGACACTCGAAGTCCACTGGGGAGAAGGAGGAGGGGGAG
ACCCCTGAAGATACTGGGACCCGGGCCTTGCCACCCAGTTGGGCTGCCCTTCCCAACTCA
GGCCAGGGCCAGAAGGAGGGTGTTTGTGGGGCATCTCCAGAGGATGAAGCTGAAGAGGAG
GAAGAGGAGGAGGAGGAGGAGGAAGAGTGTGAACCCCAGGCAGTGCCAGTGTCTCCGGCC
TCAGCTTGCAGCCCCCCGCTGCAGCAGCCACAGGGCTCCCGGGTGCTGGCCACCCTACGT
GGCCAGGTGCTCCTGGGCAGGGGCGTGGGTGCTATAGGTGGGCAGTGGTGGCGTCGACGG
GCGCAGCTGACCCGGGAGAAGCGCTTCACCTTCGTGCTGGCTGTGGTCATTGGCGTTTTT
GTGCTCTGCTGGTTCCCCTTCTTCTTCAGCTACAGCCTGGGAGCCATCTGCCCGAAGCAC
TGCAAGGTGCCCCATGGCCTCTTCCAGTTCTTCTTCTGGATCGGCTACTGCAACAGCTCA
CTGAACCCTGTTATCTACACCATCTTCAACCAGGACTTCCGCCGTGCCTTCCGGAGGATC
CTGTGCCGCCCGTGGACCCAGACGGCCTGGTGA
Chromosome Location
2
Locus
2p13-q13
External Identifiers
ResourceLink
UniProtKB IDP18089
UniProtKB Entry NameADA2B_HUMAN
GenBank Protein ID178198
GenBank Gene IDM34041
GenAtlas IDADRA2B
HGNC IDHGNC:282
General References
  1. Lomasney JW, Lorenz W, Allen LF, King K, Regan JW, Yang-Feng TL, Caron MG, Lefkowitz RJ: Expansion of the alpha 2-adrenergic receptor family: cloning and characterization of a human alpha 2-adrenergic receptor subtype, the gene for which is located on chromosome 2. Proc Natl Acad Sci U S A. 1990 Jul;87(13):5094-8. [PubMed:2164221]
  2. Weinshank RL, Zgombick JM, Macchi M, Adham N, Lichtblau H, Branchek TA, Hartig PR: Cloning, expression, and pharmacological characterization of a human alpha 2B-adrenergic receptor. Mol Pharmacol. 1990 Nov;38(5):681-8. [PubMed:2172775]
  3. Small KM, Brown KM, Forbes SL, Liggett SB: Polymorphic deletion of three intracellular acidic residues of the alpha 2B-adrenergic receptor decreases G protein-coupled receptor kinase-mediated phosphorylation and desensitization. J Biol Chem. 2001 Feb 16;276(7):4917-22. Epub 2000 Oct 30. [PubMed:11056163]
  4. Cayla C, Heinonen P, Viikari L, Schaak S, Snapir A, Bouloumie A, Karvonen MK, Pesonen U, Scheinin M, Paris H: Cloning, characterisation and identification of several polymorphisms in the promoter region of the human alpha2B-adrenergic receptor gene. Biochem Pharmacol. 2004 Feb 1;67(3):469-78. [PubMed:15037199]
  5. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  6. Chang AC, Ho TF, Chang NC: In vitro amplification by polymerase chain reaction of a partial gene encoding the third subtype of alpha-2 adrenergic receptor in humans. Biochem Biophys Res Commun. 1990 Oct 30;172(2):817-23. [PubMed:2173582]
  7. Li C, Fan Y, Lan TH, Lambert NA, Wu G: Rab26 modulates the cell surface transport of alpha2-adrenergic receptors from the Golgi. J Biol Chem. 2012 Dec 14;287(51):42784-94. doi: 10.1074/jbc.M112.410936. Epub 2012 Oct 26. [PubMed:23105096]
  8. De Fusco M, Vago R, Striano P, Di Bonaventura C, Zara F, Mei D, Kim MS, Muallem S, Chen Y, Wang Q, Guerrini R, Casari G: The alpha2B-adrenergic receptor is mutant in cortical myoclonus and epilepsy. Ann Neurol. 2014 Jan;75(1):77-87. doi: 10.1002/ana.24028. Epub 2014 Jan 2. [PubMed:24114805]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00800FenoldopamapprovedunknownantagonistDetails
DB01392Yohimbineapproved, investigational, vet_approvedyesantagonistDetails
DB00484BrimonidineapprovedyesagonistDetails
DB00368NorepinephrineapprovedyesagonistDetails
DB00696Ergotamineapprovedunknownagonistpartial agonistDetails
DB04855DronedaroneapprovedunknownDetails
DB05461OPC-28326investigationalunknownDetails
DB05492Epicept NP-1investigationalunknownDetails
DB06262Droxidopaapproved, investigationalyesagonistDetails
DB06216AsenapineapprovedunknownantagonistDetails
DB06229OcaperidoneinvestigationalunknownDetails
DB00575ClonidineapprovedyesagonistDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01200Bromocriptineapproved, investigationalunknownagonistDetails
DB00589Lisurideapproved, investigationalunknownother/unknownDetails
DB00248CabergolineapprovedunknownantagonistDetails
DB00714Apomorphineapproved, investigationalunknownagonistDetails
DB00734Risperidoneapproved, investigationalunknownantagonistagonistDetails
DB01267PaliperidoneapprovedunknownantagonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB00246ZiprasidoneapprovednoantagonistDetails
DB00363ClozapineapprovednoantagonistDetails
DB01238Aripiprazoleapproved, investigationalnoantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB00292EtomidateapprovedyesagonistDetails
DB00726Trimipramineapprovedunknownother/unknownDetails
DB00925PhenoxybenzamineapprovedunknownantagonistDetails
DB01363Ephedra sinica rootnutraceuticalyesagonistDetails
DB01577Metamfetamineapproved, illicityesagonistDetails
DB06694Xylometazolineapproved, investigationalyesagonistDetails
DB00668Epinephrineapproved, vet_approvedyesagonistDetails
DB05271RotigotineapprovedunknownantagonistDetails
DB00408LoxapineapprovedunknownbinderDetails
DB01136Carvedilolapproved, investigationalunknownantagonistDetails
DB00457PrazosinapprovedunknownbinderDetails
DB00629Guanabenzapproved, investigationalunknownbinderDetails
DB00797Tolazolineapproved, vet_approvedunknownbinderDetails
DB00935Oxymetazolineapproved, investigationalunknownbinderDetails
DB00964ApraclonidineapprovedunknownagonistDetails
DB01018Guanfacineapproved, investigationalunknownbinderDetails
DB06148Mianserinapproved, investigationalunknownantagonistDetails
DB11124RacepinephrineapprovedyesagonistDetails
DB06153PizotifenapprovedunknownantagonistDetails
DB04846Celiprololapproved, investigationalunknownantagonistDetails
DB14185Aripiprazole lauroxilapproved, investigationalnoDetails
DB00697Tizanidineapproved, investigationalunknownagonistDetails
DB00217BethanidineapprovedyesagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00540NortriptylineapprovedunknownantagonistDetails
DB00934Maprotilineapproved, investigationalunknownantagonistDetails
DB01151Desipramineapproved, investigationalunknownbinderDetails
DB09202CirazolineexperimentalyesantagonistDetails
DB06678EsmirtazapineinvestigationalunknownantagonistDetails
DB06707LevonordefrinapprovedyesagonistDetails
DB13025TiaprideinvestigationalyesantagonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB09304SetiptilineexperimentalunknownantagonistDetails
DB00397Phenylpropanolamineapproved, vet_approved, withdrawnunknownDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB09195LorpiprazoleapprovedyesantagonistDetails
DB11477Xylazinevet_approvedyesagonistDetails
DB00433Prochlorperazineapproved, vet_approvednoantagonistDetails
DB01365MephentermineapprovedyesagonistDetails
DB00182Amphetamineapproved, illicit, investigationalunknownagonistDetails
DB09205Moxisylyteapproved, investigationalyesantagonistDetails
DB09229AranidipineexperimentalunknownagonistDetails
DB11577Indigotindisulfonic AcidapprovednoagonistDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11273DihydroergocornineapprovedyesantagonistagonistDetails
DB11278DL-MethylephedrineapprovedyesagonistDetails
DB00268Ropiniroleapproved, investigationalunknownantagonistDetails