Beta-lactamase Ohio-1

Details

Name
Beta-lactamase Ohio-1
Synonyms
  • 3.5.2.6
Gene Name
Not Available
Organism
Enterobacter cloacae
Amino acid sequence
>lcl|BSEQ0052042|Beta-lactamase Ohio-1
MRYFRLCIISLLATLPLRVHAGPQPLEQIKLSESQLSGSVGMIEMDLARPGTLTAWRADE
RFPMMSTFKVVLCGAGLARVDAGDEQLERKIHYRRQDLVDYSPVSEKHLADGMTVGELCA
AAITMSDNSAANLLLPAVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTAR
SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGRLIRSVLPAGWFIADKTGAGERGARG
IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIAGALIEHWQR
Number of residues
286
Molecular Weight
31353.795
Theoretical pI
Not Available
GO Classification
Functions
beta-lactamase activity
Processes
beta-lactam antibiotic catabolic process / response to antibiotic
General Function
Not Available
Specific Function
Beta-lactamase activity
Pfam Domain Function
Not Available
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP18251
UniProtKB Entry NameBLA1_ENTCL
General References
  1. Shlaes DM, Currie-McCumber C, Hull A, Behlau I, Kron M: OHIO-1 beta-lactamase is part of the SHV-1 family. Antimicrob Agents Chemother. 1990 Aug;34(8):1570-6. doi: 10.1128/aac.34.8.1570. [PubMed:2121093]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01606TazobactamapprovedyesinhibitorDetails