Alpha-2C adrenergic receptor

Details

Name
Alpha-2C adrenergic receptor
Synonyms
  • ADRA2L2
  • ADRA2RL2
  • Alpha-2 adrenergic receptor subtype C4
  • Alpha-2C adrenoceptor
  • Alpha-2C adrenoreceptor
  • Alpha-2CAR
Gene Name
ADRA2C
Organism
Humans
Amino acid sequence
>lcl|BSEQ0000681|Alpha-2C adrenergic receptor
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR
RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Number of residues
462
Molecular Weight
49521.585
Theoretical pI
10.69
GO Classification
Functions
alpha-2A adrenergic receptor binding / alpha2-adrenergic receptor activity / epinephrine binding / protein heterodimerization activity / protein homodimerization activity
Processes
activation of MAPK activity by adrenergic receptor signaling pathway / activation of protein kinase B activity / adenylate cyclase-inhibiting adrenergic receptor signaling pathway / blood coagulation / cell-cell signaling / energy reserve metabolic process / epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway / female pregnancy / G-protein coupled receptor signaling pathway / negative regulation of adenylate cyclase activity / negative regulation of epinephrine secretion / negative regulation of insulin secretion involved in cellular response to glucose stimulus / negative regulation of norepinephrine secretion / negative regulation of uterine smooth muscle contraction / platelet activation / positive regulation of neuron differentiation / positive regulation of vasoconstriction / regulation of insulin secretion / regulation of sensory perception of pain / small molecule metabolic process
Components
axon terminus / cytoplasm / endosome / integral component of plasma membrane / plasma membrane
General Function
Protein homodimerization activity
Specific Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Pfam Domain Function
Transmembrane Regions
52-76 89-114 125-147 169-191 208-231 380-407 421-441
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010255|Alpha-2C adrenergic receptor (ADRA2C)
ATGGCGTCCCCGGCGCTGGCGGCGGCGCTGGCGGTGGCGGCAGCGGCGGGCCCCAATGCG
AGCGGCGCGGGCGAGAGGGGCAGCGGCGGGGTTGCCAATGCCTCGGGGGCTTCCTGGGGG
CCGCCGCGCGGCCAGTACTCGGCGGGCGCGGTGGCAGGGCTGGCTGCCGTGGTGGGCTTC
CTCATCGTCTTCACCGTGGTGGGCAACGTGCTGGTGGTGATCGCCGTGCTGACCAGCCGG
GCGCTGCGCGCGCCACAGAACCTCTTCCTGGTGTCGCTGGCCTCGGCCGACATCCTGGTG
GCCACGCTGGTCATGCCCTTCTCGTTGGCCAACGAGCTCATGGCCTACTGGTACTTCGGG
CAGGTGTGGTGCGGCGTGTACCTGGCGCTCGATGTGCTGTTTTGCACCTCGTCGATCGTG
CATCTGTGTGCCATCAGCCTGGACCGCTACTGGTCGGTGACGCAGGCCGTCGAGTACAAC
CTGAAGCGCACACCACGCCGCGTCAAGGCCACCATCGTGGCCGTGTGGCTCATCTCGGCC
GTCATCTCCTTCCCGCCGCTGGTCTCGCTCTACCGCCAGCCCGACGGCGCCGCCTACCCG
CAGTGCGGCCTCAACGACGAGACCTGGTACATCCTGTCCTCCTGCATCGGCTCCTTCTTC
GCGCCCTGCCTCATCATGGGCCTGGTCTACGCGCGCATCTACCGAGTGGCCAAGCTGCGC
ACGCGCACGCTCAGCGAGAAGCGCGCCCCCGTGGGCCCCGACGGTGCGTCCCCGACTACC
GAAAACGGGCTGGGCGCGGCGGCAGGCGCAGGCGAGAACGGGCACTGCGCGCCCCCGCCC
GCCGACGTGGAGCCGGACGAGAGCAGCGCAGCGGCCGAGAGGCGGCGGCGCCGGGGCGCG
TTGCGGCGGGGCGGGCGGCGGCGAGCGGGCGCGGAGGGGGGCGCGGGCGGTGCGGACGGG
CAGGGGGCGGGGCCGGGGGCGGCTGAGTCGGGGGCGCTGACCGCCTCCAGGTCCCCGGGG
CCCGGTGGCCGCCTGTCGCGCGCCAGCTCGCGCTCCGTCGAGTTCTTCCTGTCGCGCCGG
CGCCGGGCGCGCAGCAGCGTGTGCCGCCGCAAGGTGGCCCAGGCGCGCGAGAAGCGCTTC
ACCTTTGTGCTGGCTGTGGTCATGGGCGTGTTCGTGCTCTGCTGGTTCCCCTTCTTCTTC
AGCTACAGCCTGTACGGCATCTGCCGCGAGGCCTGCCAGGTGCCCGGCCCGCTCTTCAAG
TTCTTCTTCTGGATCGGCTACTGCAACAGCTCGCTCAACCCGGTCATCTACACGGTCTTC
AACCAGGATTTCCGGCGATCCTTTAAGCACATCCTCTTCCGACGGAGGAGAAGGGGCTTC
AGGCAGTGA
Chromosome Location
4
Locus
4p16
External Identifiers
ResourceLink
UniProtKB IDP18825
UniProtKB Entry NameADA2C_HUMAN
GenBank Protein ID178194
GenBank Gene IDJ03853
GenAtlas IDADRA2C
HGNC IDHGNC:283
General References
  1. Regan JW, Kobilka TS, Yang-Feng TL, Caron MG, Lefkowitz RJ, Kobilka BK: Cloning and expression of a human kidney cDNA for an alpha 2-adrenergic receptor subtype. Proc Natl Acad Sci U S A. 1988 Sep;85(17):6301-5. [PubMed:2842764]
  2. Schaak S, Devedjian JC, Cayla C, Sender Y, Paris H: Molecular cloning, sequencing and functional study of the promoter region of the human alpha2C4-adrenergic receptor gene. Biochem J. 1997 Dec 1;328 ( Pt 2):431-8. [PubMed:9371698]
  3. Small KM, Forbes SL, Rahman FF, Bridges KM, Liggett SB: A four amino acid deletion polymorphism in the third intracellular loop of the human alpha 2C-adrenergic receptor confers impaired coupling to multiple effectors. J Biol Chem. 2000 Jul 28;275(30):23059-64. [PubMed:10801795]
  4. Small KM, Mialet-Perez J, Seman CA, Theiss CT, Brown KM, Liggett SB: Polymorphisms of cardiac presynaptic alpha2C adrenergic receptors: Diverse intragenic variability with haplotype-specific functional effects. Proc Natl Acad Sci U S A. 2004 Aug 31;101(35):13020-5. Epub 2004 Aug 19. [PubMed:15319474]
  5. Chhajlani V, Rangel N, Uhlen S, Wikberg JE: Identification of an additional gene belonging to the alpha 2 adrenergic receptor family in the human genome by PCR. FEBS Lett. 1991 Mar 25;280(2):241-4. [PubMed:1849485]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00800FenoldopamapprovedunknownantagonistDetails
DB01392Yohimbineapproved, investigational, vet_approvedyesantagonistDetails
DB00484BrimonidineapprovedyesagonistDetails
DB00368NorepinephrineapprovedyesagonistDetails
DB04855DronedaroneapprovedunknownDetails
DB05461OPC-28326investigationalunknownDetails
DB05492Epicept NP-1investigationalunknownDetails
DB06262Droxidopaapproved, investigationalyesagonistDetails
DB06216AsenapineapprovedunknownantagonistDetails
DB06229OcaperidoneinvestigationalunknownDetails
DB00575ClonidineapprovedyesagonistDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01200Bromocriptineapproved, investigationalunknownagonistDetails
DB00589Lisurideapproved, investigationalunknownother/unknownDetails
DB00248CabergolineapprovedunknownantagonistDetails
DB00413Pramipexoleapproved, investigationalunknownunknownDetails
DB00714Apomorphineapproved, investigationalunknownagonistDetails
DB00734Risperidoneapproved, investigationalunknownagonistDetails
DB01267PaliperidoneapprovedunknownagonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB00697Tizanidineapproved, investigationalyesagonistDetails
DB00246ZiprasidoneapprovednoantagonistDetails
DB00363ClozapineapprovednoantagonistDetails
DB01238Aripiprazoleapproved, investigationalnoantagonistother/unknownDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB01142Doxepinapproved, investigationalunknownantagonistDetails
DB00925PhenoxybenzamineapprovedunknownantagonistDetails
DB01363Ephedraapproved, nutraceutical, withdrawnyesagonistDetails
DB01577Metamfetamineapproved, illicityesagonistDetails
DB06694Xylometazolineapproved, investigationalunknownagonistDetails
DB08815Lurasidoneapproved, investigationalunknownantagonistDetails
DB04946IloperidoneapprovedunknownantagonistDetails
DB08838Agmatineexperimental, investigationalyesagonistDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00370MirtazapineapprovedunknownbinderDetails
DB01136Carvedilolapproved, investigationalunknownantagonistDetails
DB00797Tolazolineapproved, vet_approvedunknownbinderDetails
DB00935Oxymetazolineapproved, investigationalunknownagonistDetails
DB06148Mianserinapproved, investigationalunknownantagonistDetails
DB09128Brexpiprazoleapproved, investigationalyesantagonistDetails
DB11124RacepinephrineapprovedyesagonistDetails
DB06153PizotifenapprovedunknownantagonistDetails
DB04846Celiprololapproved, investigationalunknownantagonistDetails
DB14185Aripiprazole lauroxilapproved, investigationalnoDetails
DB00217BethanidineapprovedyesagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00540NortriptylineapprovedunknownantagonistDetails
DB00934Maprotilineapproved, investigationalunknownantagonistDetails
DB01151Desipramineapproved, investigationalunknownbinderDetails
DB09202CirazolineexperimentalyesantagonistDetails
DB06678EsmirtazapineinvestigationalunknownantagonistDetails
DB06707LevonordefrinapprovedyesagonistDetails
DB13025TiaprideinvestigationalyesantagonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB09304SetiptilineexperimentalunknownantagonistDetails
DB00397Phenylpropanolamineapproved, vet_approved, withdrawnunknownDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB09195LorpiprazoleapprovedyesantagonistDetails
DB11477Xylazinevet_approvedyesagonistDetails
DB01365MephentermineapprovedyesagonistDetails
DB00182Amphetamineapproved, illicit, investigationalunknownagonistDetails
DB09205Moxisylyteapproved, investigationalyesantagonistDetails
DB09229AranidipineexperimentalunknownagonistDetails
DB11577Indigotindisulfonic AcidapprovednoagonistDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11273DihydroergocornineapprovedyesantagonistagonistDetails
DB11278DL-MethylephedrineapprovedyesagonistDetails
DB00268Ropiniroleapproved, investigationalunknownantagonistDetails