DNA ligase 1

Details

Name
DNA ligase 1
Synonyms
  • 6.5.1.1
  • DNA ligase I
  • Polydeoxyribonucleotide synthase [ATP] 1
Gene Name
LIG1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0000397|DNA ligase 1
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKA
ARVLGSEGEEEDEALSPAKGQKPALDCSQVSPPRPATSPENNASLSDTSPMDSSPSGIPK
RRTARKQLPKRTIQEVLEEQSEDEDREAKRKKEEEEEETPKESLTEAEVATEKEGEDGDQ
PTTPPKPLKTSKAETPTESVSEPEVATKQELQEEEEQTKPPRRAPKTLSSFFTPRKPAVK
KEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIE
EVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQ
ATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST
AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAM
VDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPL
KPMLAHPTRGISEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPD
IISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
DLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCE
GLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLL
ASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSA
VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQ
SQIQNQQGEDSGSDPEDTY
Number of residues
919
Molecular Weight
101735.11
Theoretical pI
5.3
GO Classification
Functions
ATP binding / DNA binding / DNA ligase (ATP) activity / DNA ligase activity / metal ion binding
Processes
anatomical structure morphogenesis / base-excision repair / cell division / DNA biosynthetic process / DNA ligation / DNA metabolic process / DNA repair / DNA strand elongation involved in DNA replication / double-strand break repair via nonhomologous end joining / global genome nucleotide-excision repair / mismatch repair / mitotic cell cycle / nucleotide-excision repair / nucleotide-excision repair, DNA gap filling / Okazaki fragment processing involved in mitotic DNA replication / removal of RNA primer involved in mitotic DNA replication / response to hydrogen peroxide / telomere maintenance / telomere maintenance via recombination / telomere maintenance via semi-conservative replication / transcription-coupled nucleotide-excision repair
Components
Golgi apparatus / intracellular membrane-bounded organelle / mitochondrion / nucleoplasm / nucleus
General Function
Metal ion binding
Specific Function
DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Nucleus
Gene sequence
>lcl|BSEQ0010000|DNA ligase 1 (LIG1)
ATGCAGCGAAGTATCATGTCATTTTTCCACCCCAAGAAAGAGGGTAAAGCAAAGAAGCCT
GAGAAGGAGGCATCCAATAGCAGCAGAGAGACGGAGCCCCCTCCAAAGGCGGCACTGAAG
GAGTGGAATGGAGTGGTGTCCGAGAGTGACTCTCCGGTGAAGAGGCCAGGGAGGAAGGCG
GCCCGGGTCCTGGGCAGCGAAGGGGAAGAGGAGGATGAAGCCCTTAGCCCTGCTAAAGGC
CAGAAGCCTGCCCTGGACTGCTCACAGGTCTCCCCGCCCCGTCCTGCCACATCTCCTGAG
AACAATGCTTCCCTCTCTGACACCTCTCCCATGGACAGTTCCCCATCAGGGATTCCGAAG
CGTCGCACAGCTCGGAAGCAGCTCCCGAAACGGACCATTCAGGAAGTCCTGGAAGAGCAG
AGTGAGGACGAGGACAGAGAAGCCAAGAGGAAGAAGGAGGAGGAAGAAGAGGAGACCCCG
AAAGAAAGCCTCACAGAGGCTGAAGTGGCCACAGAGAAGGAAGGAGAAGACGGGGACCAG
CCCACCACGCCTCCCAAGCCCCTAAAGACCTCCAAAGCAGAGACCCCGACGGAAAGCGTT
TCAGAGCCTGAGGTGGCCACGAAGCAGGAACTGCAGGAGGAGGAAGAGCAGACCAAGCCT
CCCCGCAGAGCTCCCAAGACGCTCAGCAGCTTCTTCACCCCCCGGAAGCCAGCAGTCAAA
AAAGAAGTGAAGGAAGAGGAGCCAGGGGCTCCAGGAAAGGAGGGAGCTGCTGAGGGACCC
CTGGATCCATCTGGTTACAATCCTGCCAAGAACAACTATCATCCCGTGGAAGATGCCTGC
TGGAAACCGGGCCAGAAGGTTCCTTACCTGGCTGTGGCCCGGACGTTTGAGAAGATCGAG
GAGGTGTCTGCTCGGCTCCGGATGGTGGAGACGCTGAGCAACTTGCTGCGCTCCGTGGTG
GCCCTGTCGCCTCCAGACCTCCTCCCTGTCCTCTACCTCAGCCTCAACCACCTTGGGCCA
CCCCAGCAGGGCCTGGAGCTTGGCGTGGGTGATGGTGTCCTTCTCAAGGCAGTGGCCCAG
GCCACAGGTCGGCAGCTGGAGTCCGTCCGGGCTGAGGCAGCCGAGAAAGGCGACGTGGGG
CTGGTGGCCGAGAACAGCCGCAGCACCCAGAGGCTCATGCTGCCACCACCTCCGCTCACT
GCCTCCGGGGTCTTCAGCAAGTTCCGCGACATCGCCAGGCTCACTGGCAGTGCTTCCACA
GCCAAGAAGATAGACATCATCAAAGGCCTCTTTGTGGCCTGCCGCCACTCAGAAGCCCGG
TTCATCGCTAGGTCCCTGAGCGGACGGCTGCGCCTTGGGCTGGCAGAGCAGTCGGTGCTG
GCTGCCCTCTCCCAGGCAGTGAGCCTCACGCCCCCGGGCCAAGAATTCCCACCAGCCATG
GTGGATGCTGGGAAGGGCAAGACAGCAGAGGCCAGAAAGACGTGGCTGGAGGAGCAAGGC
ATGATCCTGAAGCAGACGTTCTGCGAGGTTCCCGACCTGGACCGAATTATCCCCGTGCTG
CTGGAGCACGGCCTGGAACGTCTCCCGGAGCACTGCAAGCTGAGCCCAGGGATTCCCCTG
AAACCAATGTTGGCCCATCCCACCCGGGGCATCAGCGAGGTCCTGAAACGCTTTGAGGAG
GCAGCTTTCACCTGCGAATACAAATATGACGGGCAGAGGGCACAGATCCACGCCCTGGAA
GGCGGGGAGGTGAAGATCTTCAGCAGGAATCAGGAAGACAACACTGGGAAGTACCCGGAC
ATCATCAGCCGCATCCCCAAGATTAAACTCCCATCGGTCACATCCTTCATCCTGGACACC
GAAGCCGTGGCTTGGGACCGGGAAAAGAAGCAGATCCAGCCATTCCAAGTGCTCACCACC
CGCAAACGCAAGGAGGTGGATGCGTCTGAGATCCAGGTGCAGGTGTGTTTGTACGCCTTC
GACCTCATCTACCTCAATGGAGAGTCCCTGGTACGTGAGCCCCTTTCCCGGCGCCGGCAG
CTGCTCCGGGAGAACTTTGTGGAGACAGAGGGCGAGTTTGTCTTCGCCACCTCCCTGGAC
ACCAAGGACATCGAGCAGATCGCCGAGTTCCTGGAGCAGTCAGTGAAAGACTCCTGCGAG
GGGCTGATGGTGAAGACCCTGGATGTTGATGCCACCTACGAGATCGCCAAGAGATCGCAC
AACTGGCTCAAGCTGAAGAAGGACTACCTTGATGGCGTGGGTGACACCCTGGACCTGGTG
GTGATCGGCGCCTACCTGGGCCGGGGGAAGCGGGCCGGCCGGTACGGGGGCTTCCTGCTG
GCCTCCTACGACGAGGACAGTGAGGAGCTGCAGGCCATATGCAAGCTTGGAACTGGCTTC
AGTGATGAGGAGCTGGAGGAGCATCACCAGAGCCTCAAGGCGCTGGTGCTGCCCAGCCCA
CGCCCTTACGTGCGGATAGATGGCGCTGTGATTCCCGACCACTGGCTGGACCCCAGCGCT
GTGTGGGAGGTGAAGTGCGCTGACCTCTCCCTCTCTCCCATCTACCCTGCTGCGCGGGGC
CTGGTGGATAGTGACAAGGGCATCTCCCTTCGCTTCCCTCGGTTTATTCGAGTCCGTGAA
GACAAGCAGCCGGAGCAGGCCACCACCAGTGCTCAGGTGGCCTGTTTGTACCGGAAGCAA
AGTCAGATTCAGAACCAACAAGGCGAGGACTCAGGCTCTGACCCTGAAGATACCTACTAA
Chromosome Location
19
Locus
19q13.2-q13.3
External Identifiers
ResourceLink
UniProtKB IDP18858
UniProtKB Entry NameDNLI1_HUMAN
GenBank Protein ID187143
GenBank Gene IDM36067
GenAtlas IDLIG1
HGNC IDHGNC:6598
General References
  1. Barnes DE, Johnston LH, Kodama K, Tomkinson AE, Lasko DD, Lindahl T: Human DNA ligase I cDNA: cloning and functional expression in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A. 1990 Sep;87(17):6679-83. [PubMed:2204063]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Petrini JH, Huwiler KG, Weaver DT: A wild-type DNA ligase I gene is expressed in Bloom's syndrome cells. Proc Natl Acad Sci U S A. 1991 Sep 1;88(17):7615-9. [PubMed:1881902]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983]
  7. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243]
  8. Tang LY, Deng N, Wang LS, Dai J, Wang ZL, Jiang XS, Li SJ, Li L, Sheng QH, Wu DQ, Li L, Zeng R: Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction. Mol Cell Proteomics. 2007 Nov;6(11):1952-67. Epub 2007 Aug 12. [PubMed:17693683]
  9. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  10. Tan F, Lu L, Cai Y, Wang J, Xie Y, Wang L, Gong Y, Xu BE, Wu J, Luo Y, Qiang B, Yuan J, Sun X, Peng X: Proteomic analysis of ubiquitinated proteins in normal hepatocyte cell line Chang liver cells. Proteomics. 2008 Jul;8(14):2885-96. doi: 10.1002/pmic.200700887. [PubMed:18655026]
  11. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330]
  12. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332]
  13. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  14. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  15. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. [PubMed:21406692]
  16. Baple EL, Chambers H, Cross HE, Fawcett H, Nakazawa Y, Chioza BA, Harlalka GV, Mansour S, Sreekantan-Nair A, Patton MA, Muggenthaler M, Rich P, Wagner K, Coblentz R, Stein CK, Last JI, Taylor AM, Jackson AP, Ogi T, Lehmann AR, Green CM, Crosby AH: Hypomorphic PCNA mutation underlies a human DNA repair disorder. J Clin Invest. 2014 Jul;124(7):3137-46. doi: 10.1172/JCI74593. Epub 2014 Jun 9. [PubMed:24911150]
  17. Pascal JM, O'Brien PJ, Tomkinson AE, Ellenberger T: Human DNA ligase I completely encircles and partially unwinds nicked DNA. Nature. 2004 Nov 25;432(7016):473-8. [PubMed:15565146]
  18. Barnes DE, Tomkinson AE, Lehmann AR, Webster AD, Lindahl T: Mutations in the DNA ligase I gene of an individual with immunodeficiencies and cellular hypersensitivity to DNA-damaging agents. Cell. 1992 May 1;69(3):495-503. [PubMed:1581963]
  19. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00290Bleomycinapproved, investigationalunknowninhibitorDetails