Chorismate mutase AroH

Details

Name
Chorismate mutase AroH
Synonyms
  • 5.4.99.5
  • CM
Gene Name
aroH
Organism
Bacillus subtilis (strain 168)
Amino acid sequence
>lcl|BSEQ0011055|Chorismate mutase AroH
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAK
AVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKVVVLRPDLS
LTKNTEL
Number of residues
127
Molecular Weight
14516.91
Theoretical pI
5.7
GO Classification
Functions
chorismate mutase activity
Processes
aromatic amino acid family biosynthetic process / chorismate metabolic process
Components
cytoplasm
General Function
Chorismate mutase activity
Specific Function
Catalyzes the Claisen rearrangement of chorismate to prephenate. Probably involved in the aromatic amino acid biosynthesis.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0011056|Chorismate mutase AroH (aroH)
ATGATGATTCGCGGAATTCGCGGAGCAACTACAGTTGAACGGGATACTGAAGAAGAAATT
TTACAAAAAACTAAACAGCTGTTAGAGAAAATCATAGAAGAAAATCATACAAAACCGGAA
GATGTTGTTCAAATGCTTCTGTCGGCTACACCTGATTTGCACGCTGTTTTCCCGGCAAAA
GCTGTTCGCGAGCTTTCAGGATGGCAGTATGTACCGGTAACATGTATGCAGGAAATGGAC
GTAACAGGCGGTCTGAAAAAGTGCATAAGAGTCATGATGACGGTCCAGACAGATGTCCCT
CAGGATCAGATCAGACATGTATATTTAGAAAAAGTTGTCGTATTGAGGCCCGATTTATCA
TTGACAAAAAATACTGAATTGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP19080
UniProtKB Entry NameAROH_BACSU
GenBank Protein ID142536
GenBank Gene IDM32278
General References
  1. Gray JV, Golinelli-Pimpaneau B, Knowles JR: Monofunctional chorismate mutase from Bacillus subtilis: purification of the protein, molecular cloning of the gene, and overexpression of the gene product in Escherichia coli. Biochemistry. 1990 Jan 16;29(2):376-83. [PubMed:2105742]
  2. Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [PubMed:9384377]
  3. Rajagopalan JS, Taylor KM, Jaffe EK: 13C NMR studies of the enzyme-product complex of Bacillus subtilis chorismate mutase. Biochemistry. 1993 Apr 20;32(15):3965-72. [PubMed:8471608]
  4. Chook YM, Ke H, Lipscomb WN: Crystal structures of the monofunctional chorismate mutase from Bacillus subtilis and its complex with a transition state analog. Proc Natl Acad Sci U S A. 1993 Sep 15;90(18):8600-3. [PubMed:8378335]
  5. Chook YM, Gray JV, Ke H, Lipscomb WN: The monofunctional chorismate mutase from Bacillus subtilis. Structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications for the mechanism of the enzymatic reaction. J Mol Biol. 1994 Jul 29;240(5):476-500. [PubMed:8046752]
  6. Ladner JE, Reddy P, Davis A, Tordova M, Howard AJ, Gilliland GL: The 1.30 A resolution structure of the Bacillus subtilis chorismate mutase catalytic homotrimer. Acta Crystallogr D Biol Crystallogr. 2000 Jun;56(Pt 6):673-83. [PubMed:10818343]
  7. Kast P, Grisostomi C, Chen IA, Li S, Krengel U, Xue Y, Hilvert D: A strategically positioned cation is crucial for efficient catalysis by chorismate mutase. J Biol Chem. 2000 Nov 24;275(47):36832-8. [PubMed:10960481]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB021533-sulfino-L-alanineexperimentalunknownDetails
DB08427PREPHENIC ACIDexperimentalunknownDetails
DB08648(1R,3S,5S,8R)-8-Hydroxy-2-oxabicyclo[3.3.1]non-6-ene-3,5-dicarboxylic acidexperimentalunknownDetails