Inter-alpha-trypsin inhibitor heavy chain H2

Details

Name
Inter-alpha-trypsin inhibitor heavy chain H2
Synonyms
  • IGHEP2
  • Inter-alpha-trypsin inhibitor complex component II
  • ITI heavy chain H2
  • Serum-derived hyaluronan-associated protein
  • SHAP
Gene Name
ITIH2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049832|Inter-alpha-trypsin inhibitor heavy chain H2
MKRLTCFFICFFLSEVSGFEIPINGLSEFVDYEDLVELAPGKFQLVAENRRYQRSLPGES
EEMMEEVDQVTLYSYKVQSTITSRMATTMIQSKVVNNSPQPQNVVFDVQIPKGAFISNFS
MTVDGKTFRSSIKEKTVGRALYAQARAKGKTAGLVRSSALDMENFRTEVNVLPGAKVQFE
LHYQEVKWRKLGSYEHRIYLQPGRLAKHLEVDVWVIEPQGLRFLHVPDTFEGHFDGVPVI
SKGQQKAHVSFKPTVAQQRICPNCRETAVDGELVVLYDVKREEKAGELEVFNGYFVHFFA
PDNLDPIPKNILFVIDVSGSMWGVKMKQTVEAMKTILDDLRAEDHFSVIDFNQNIRTWRN
DLISATKTQVADAKRYIEKIQPSGGTNINEALLRAIFILNEANNLGLLDPNSVSLIILVS
DGDPTVGELKLSKIQKNVKENIQDNISLFSLGMGFDVDYDFLKRLSNENHGIAQRIYGNQ
DTSSQLKKFYNQVSTPLLRNVQFNYPHTSVTDVTQNNFHNYFGGSEIVVAGKFDPAKLDQ
IESVITATSANTQLVLETLAQMDDLQDFLSKDKHADPDFTRKLWAYLTINQLLAERSLAP
TAAAKRRITRSILQMSLDHHIVTPLTSLVIENEAGDERMLADAPPQDPSCCSGALYYGSK
VVPDSTPSWANPSPTPVISMLAQGSQVLESTPPPHVMRVENDPHFIIYLPKSQKNICFNI
DSEPGKILNLVSDPESGIVVNGQLVGAKKPNNGKLSTYFGKLGFYFQSEDIKIEISTETI
TLSHGSSTFSLSWSDTAQVTNQRVQISVKKEKVVTITLDKEMSFSVLLHRVWKKHPVNVD
FLGIYIPPTNKFSPKAHGLIGQFMQEPKIHIFNERPGKDPEKPEASMEVKGQKLIITRGL
QKDYRTDLVFGTDVTCWFVHNSGKGFIDGHYKDYFVPQLYSFLKRP
Number of residues
946
Molecular Weight
106462.725
Theoretical pI
Not Available
GO Classification
Functions
endopeptidase inhibitor activity / serine-type endopeptidase inhibitor activity
Processes
hyaluronan metabolic process
Components
blood microparticle / extracellular exosome / extracellular region
General Function
May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.
Specific Function
Endopeptidase inhibitor activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0049833|Inter-alpha-trypsin inhibitor heavy chain H2 (ITIH2)
ATGAAAAGACTCACGTGCTTTTTCATCTGCTTCTTTCTTTCTGAAGTATCAGGCTTCGAA
ATCCCCATAAATGGACTTTCTGAATTTGTAGACTATGAAGATCTTGTGGAACTGGCCCCA
GGCAAATTTCAATTGGTGGCAGAGAACCGGAGATATCAGAGAAGCCTTCCAGGAGAATCG
GAAGAAATGATGGAAGAGGTTGATCAAGTAACTCTTTATAGCTATAAAGTCCAGTCTACT
ATTACTTCTCGGATGGCCACCACCATGATCCAGAGCAAAGTGGTGAACAATTCCCCGCAG
CCTCAGAATGTCGTGTTTGATGTTCAGATCCCCAAAGGAGCATTCATTTCCAACTTCTCC
ATGACTGTGGACGGCAAGACATTTAGGAGCTCTATTAAGGAGAAAACTGTGGGCCGAGCT
CTTTATGCACAGGCCAGAGCAAAAGGCAAGACGGCTGGCTTGGTGAGGAGCAGCGCTCTT
GATATGGAAAACTTCAGAACGGAAGTAAATGTCCTCCCAGGAGCAAAGGTGCAGTTCGAA
CTTCACTACCAGGAGGTGAAGTGGAGGAAGCTGGGCTCCTATGAGCACAGGATCTATCTG
CAACCTGGACGGCTGGCCAAACACTTAGAGGTAGATGTGTGGGTTATCGAACCACAGGGA
CTGAGATTTCTTCATGTTCCCGACACATTTGAAGGCCATTTCGATGGTGTTCCGGTCATT
TCTAAAGGACAACAGAAGGCGCACGTCTCCTTCAAGCCCACGGTAGCACAGCAGAGAATA
TGCCCTAACTGCCGGGAGACTGCGGTAGATGGGGAACTGGTGGTGCTGTATGACGTGAAA
AGAGAAGAGAAGGCTGGTGAACTGGAGGTGTTTAATGGATATTTTGTCCACTTCTTTGCT
CCTGACAACCTGGACCCAATTCCCAAAAACATCCTCTTTGTCATCGATGTGAGTGGCTCC
ATGTGGGGAGTTAAAATGAAACAAACTGTGGAAGCAATGAAGACCATATTGGATGACCTC
AGAGCAGAAGACCATTTCTCTGTGATTGATTTCAACCAGAACATTCGAACTTGGAGAAAT
GATTTAATTTCAGCTACAAAAACACAGGTTGCAGATGCCAAGAGGTATATTGAGAAAATC
CAGCCCAGTGGAGGCACAAACATCAACGAAGCACTCCTACGGGCAATCTTCATTTTGAAT
GAAGCCAATAACTTGGGACTGTTAGACCCCAACTCCGTCTCGCTGATCATTTTGGTTTCT
GATGGAGATCCAACAGTGGGCGAACTAAAACTGTCAAAAATTCAGAAAAACGTTAAGGAG
AACATCCAAGACAATATCTCCTTGTTCAGTTTGGGCATGGGATTTGATGTGGACTATGAT
TTTTTGAAGAGACTGTCCAATGAAAACCATGGAATTGCACAAAGGATTTATGGAAACCAG
GACACGTCTTCCCAGCTTAAGAAATTCTACAACCAGGTCTCCACTCCATTGCTCCGGAAT
GTTCAGTTCAACTATCCCCATACATCAGTCACGGACGTCACTCAAAACAATTTCCATAAC
TACTTTGGAGGCTCAGAGATTGTGGTGGCAGGAAAATTTGACCCTGCTAAATTGGATCAA
ATAGAGAGCGTTATCACGGCGACTTCGGCTAACACGCAGTTAGTCTTGGAGACCCTGGCC
CAGATGGACGACTTGCAGGATTTTCTATCGAAAGACAAGCATGCAGATCCCGATTTCACC
AGGAAACTGTGGGCCTATCTAACCATCAACCAACTGCTAGCTGAACGAAGCCTGGCTCCT
ACAGCTGCCGCCAAGAGAAGAATTACAAGATCGATCCTGCAGATGTCTCTAGACCACCAC
ATTGTGACTCCGCTGACCTCGCTGGTGATCGAGAACGAGGCTGGGGATGAGCGCATGCTG
GCGGATGCCCCACCGCAGGATCCCTCCTGCTGCTCAGGGGCCCTGTATTACGGCAGCAAA
GTGGTTCCAGATTCCACCCCGTCTTGGGCCAATCCTTCACCAACGCCCGTGATCTCCATG
CTGGCACAAGGATCTCAGGTGCTAGAGTCCACGCCACCCCCACATGTGATGAGAGTTGAA
AATGACCCACATTTCATCATTTATCTACCAAAAAGCCAAAAGAACATTTGTTTCAATATT
GACTCAGAACCTGGAAAAATCCTCAACCTGGTTTCTGACCCAGAATCAGGAATTGTAGTC
AACGGTCAGCTTGTTGGTGCCAAGAAGCCCAACAATGGAAAACTAAGCACCTATTTTGGA
AAACTGGGATTTTATTTCCAAAGTGAAGACATAAAAATAGAAATCAGCACTGAGACCATC
ACCCTGAGCCATGGTTCTAGCACATTCTCCTTGTCCTGGTCCGACACGGCTCAAGTCACG
AATCAGAGGGTGCAGATCTCAGTGAAGAAAGAAAAAGTGGTAACTATCACCCTGGATAAA
GAGATGTCCTTTTCTGTTTTACTTCATCGTGTTTGGAAGAAGCATCCCGTCAATGTTGAC
TTTCTGGGAATCTACATACCCCCTACAAACAAGTTCTCACCTAAAGCCCACGGACTAATA
GGCCAGTTCATGCAGGAACCAAAGATACACATCTTCAATGAGAGACCAGGAAAGGACCCT
GAGAAGCCAGAGGCCAGCATGGAAGTGAAGGGGCAGAAGCTGATCATCACCAGGGGCTTA
CAGAAAGACTACAGAACGGATCTAGTGTTTGGAACGGACGTTACCTGCTGGTTTGTGCAC
AACAGTGGAAAAGGATTCATTGACGGGCATTACAAGGATTACTTCGTGCCTCAGCTCTAC
AGCTTTCTCAAACGGCCTTAA
Chromosome Location
10
Locus
10p14
External Identifiers
ResourceLink
UniProtKB IDP19823
UniProtKB Entry NameITIH2_HUMAN
HGNC IDHGNC:6167
General References
  1. Gebhard W, Schreitmuller T, Hochstrasser K, Wachter E: Complementary DNA and derived amino acid sequence of the precursor of one of the three protein components of the inter-alpha-trypsin inhibitor complex. FEBS Lett. 1988 Feb 29;229(1):63-7. [PubMed:2450046]
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054]
  3. Salier JP, Diarra-Mehrpour M, Sesboue R, Bourguignon J, Benarous R, Ohkubo I, Kurachi S, Kurachi K, Martin JP: Isolation and characterization of cDNAs encoding the heavy chain of human inter-alpha-trypsin inhibitor (I alpha TI): unambiguous evidence for multipolypeptide chain structure of I alpha TI. Proc Natl Acad Sci U S A. 1987 Dec;84(23):8272-6. [PubMed:2446322]
  4. Salier JP, Diarra-Mehrpour M, Sesboue R, Bourguignon J, Martin JP: Human inter-alpha-trypsin inhibitor. Isolation and characterization of heavy (H) chain cDNA clones coding for a 383 amino-acid sequence of the H chain. Biol Chem Hoppe Seyler. 1988 May;369 Suppl:15-8. [PubMed:2462430]
  5. Schreitmuller T, Hochstrasser K, Reisinger PW, Wachter E, Gebhard W: cDNA cloning of human inter-alpha-trypsin inhibitor discloses three different proteins. Biol Chem Hoppe Seyler. 1987 Aug;368(8):963-70. [PubMed:3663330]
  6. Enghild JJ, Thogersen IB, Pizzo SV, Salvesen G: Analysis of inter-alpha-trypsin inhibitor and a novel trypsin inhibitor, pre-alpha-trypsin inhibitor, from human plasma. Polypeptide chain stoichiometry and assembly by glycan. J Biol Chem. 1989 Sep 25;264(27):15975-81. [PubMed:2476436]
  7. Malki N, Balduyck M, Maes P, Capon C, Mizon C, Han KK, Tartar A, Fournet B, Mizon J: The heavy chains of human plasma inter-alpha-trypsin inhibitor: their isolation, their identification by electrophoresis and partial sequencing. Differential reactivity with concanavalin A. Biol Chem Hoppe Seyler. 1992 Oct;373(10):1009-18. [PubMed:1384548]
  8. Enghild JJ, Salvesen G, Thogersen IB, Valnickova Z, Pizzo SV, Hefta SA: Presence of the protein-glycosaminoglycan-protein covalent cross-link in the inter-alpha-inhibitor-related proteinase inhibitor heavy chain 2/bikunin. J Biol Chem. 1993 Apr 25;268(12):8711-6. [PubMed:7682553]
  9. Wisniewski HG, Burgess WH, Oppenheim JD, Vilcek J: TSG-6, an arthritis-associated hyaluronan binding protein, forms a stable complex with the serum protein inter-alpha-inhibitor. Biochemistry. 1994 Jun 14;33(23):7423-9. [PubMed:7516184]
  10. Huang L, Yoneda M, Kimata K: A serum-derived hyaluronan-associated protein (SHAP) is the heavy chain of the inter alpha-trypsin inhibitor. J Biol Chem. 1993 Dec 15;268(35):26725-30. [PubMed:7504674]
  11. Morelle W, Capon C, Balduyck M, Sautiere P, Kouach M, Michalski C, Fournet B, Mizon J: Chondroitin sulphate covalently cross-links the three polypeptide chains of inter-alpha-trypsin inhibitor. Eur J Biochem. 1994 Apr 15;221(2):881-8. [PubMed:7513643]
  12. Flahaut C, Capon C, Balduyck M, Ricart G, Sautiere P, Mizon J: Glycosylation pattern of human inter-alpha-inhibitor heavy chains. Biochem J. 1998 Aug 1;333 ( Pt 3):749-56. [PubMed:9677337]
  13. Olsen EH, Rahbek-Nielsen H, Thogersen IB, Roepstorff P, Enghild JJ: Posttranslational modifications of human inter-alpha-inhibitor: identification of glycans and disulfide bridges in heavy chains 1 and 2. Biochemistry. 1998 Jan 6;37(1):408-16. [PubMed:9425062]
  14. Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. [PubMed:12754519]
  15. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952]
  16. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218]
  17. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  18. Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G: Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD. Mol Cell Proteomics. 2012 Apr;11(4):M111.013649. doi: 10.1074/mcp.M111.013649. Epub 2011 Dec 14. [PubMed:22171320]
  19. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  20. Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE: A Single Kinase Generates the Majority of the Secreted Phosphoproteome. Cell. 2015 Jun 18;161(7):1619-32. doi: 10.1016/j.cell.2015.05.028. [PubMed:26091039]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09130Copperapproved, investigationalunknownDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails