Inter-alpha-trypsin inhibitor heavy chain H1

Details

Name
Inter-alpha-trypsin inhibitor heavy chain H1
Synonyms
  • IGHEP1
  • Inter-alpha-trypsin inhibitor complex component III
  • ITI heavy chain H1
  • Serum-derived hyaluronan-associated protein
  • SHAP
Gene Name
ITIH1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049870|Inter-alpha-trypsin inhibitor heavy chain H1
MDGAMGPRGLLLCMYLVSLLILQAMPALGSATGRSKSSEKRQAVDTAVDGVFIRSLKVNC
KVTSRFAHYVVTSQVVNTANEAREVAFDLEIPKTAFISDFAVTADGNAFIGDIKDKVTAW
KQYRKAAISGENAGLVRASGRTMEQFTIHLTVNPQSKVTFQLTYEEVLKRNHMQYEIVIK
VKPKQLVHHFEIDVDIFEPQGISKLDAQASFLPKELAAQTIKKSFSGKKGHVLFRPTVSQ
QQSCPTCSTSLLNGHFKVTYDVSRDKICDLLVANNHFAHFFAPQNLTNMNKNVVFVIDIS
GSMRGQKVKQTKEALLKILGDMQPGDYFDLVLFGTRVQSWKGSLVQASEANLQAAQDFVR
GFSLDEATNLNGGLLRGIEILNQVQESLPELSNHASILIMLTDGDPTEGVTDRSQILKNV
RNAIRGRFPLYNLGFGHNVDFNFLEVMSMENNGRAQRIYEDHDATQQLQGFYSQVAKPLL
VDVDLQYPQDAVLALTQNHHKQYYEGSEIVVAGRIADNKQSSFKADVQAHGEGQEFSITC
LVDEEEMKKLLRERGHMLENHVERLWAYLTIQELLAKRMKVDREERANLSSQALQMSLDY
GFVTPLTSMSIRGMADQDGLKPTIDKPSEDSPPLEMLGPRRTFVLSALQPSPTHSSSNTQ
RLPDRVTGVDTDPHFIIHVPQKEDTLCFNINEEPGVILSLVQDPNTGFSVNGQLIGNKAR
SPGQHDGTYFGRLGIANPATDFQLEVTPQNITLNPGFGGPVFSWRDQAVLRQDGVVVTIN
KKRNLVVSVDDGGTFEVVLHRVWKGSSVHQDFLGFYVLDSHRMSARTHGLLGQFFHPIGF
EVSDIHPGSDPTKPDATMVVRNRRLTVTRGLQKDYSKDPWHGAEVSCWFIHNNGAGLIDG
AYTDYIVPDIF
Number of residues
911
Molecular Weight
101388.49
Theoretical pI
Not Available
GO Classification
Functions
calcium ion binding / serine-type endopeptidase inhibitor activity
Processes
hyaluronan metabolic process
Components
blood microparticle / extracellular exosome / extracellular region
General Function
May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.
Specific Function
Calcium ion binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0049871|Inter-alpha-trypsin inhibitor heavy chain H1 (ITIH1)
ATGGACGGTGCCATGGGGCCTCGGGGGCTGCTGTTGTGCATGTACCTGGTATCTCTCCTC
ATCCTGCAGGCCATGCCTGCCCTGGGCTCGGCTACAGGCAGGTCCAAGAGCAGCGAGAAG
CGACAGGCTGTGGACACCGCTGTCGATGGCGTGTTCATCCGGAGTTTGAAAGTCAACTGC
AAAGTCACCTCTCGCTTCGCCCACTATGTTGTCACCAGCCAAGTGGTCAACACTGCCAAT
GAAGCCAGGGAAGTGGCCTTCGACCTGGAAATCCCCAAGACAGCATTCATCAGTGACTTT
GCCGTTACAGCAGATGGAAACGCATTTATCGGAGACATAAAGGACAAGGTGACTGCATGG
AAGCAGTACCGGAAAGCAGCTATCTCAGGAGAGAATGCCGGCCTTGTCAGGGCCTCGGGG
AGAACTATGGAGCAATTCACCATCCACCTCACCGTCAATCCCCAGAGCAAGGTCACGTTT
CAGCTGACTTATGAGGAAGTGCTGAAGAGAAACCATATGCAGTATGAAATTGTCATCAAA
GTCAAGCCCAAGCAGCTGGTGCATCATTTTGAGATTGATGTGGACATCTTCGAGCCCCAG
GGGATCAGCAAGCTGGATGCCCAGGCCTCTTTCCTGCCGAAGGAACTGGCAGCCCAAACT
ATCAAGAAGTCCTTCTCAGGAAAAAAGGGTCATGTGCTGTTCCGTCCCACCGTGAGCCAG
CAGCAGTCCTGCCCCACATGCTCTACATCCTTACTGAACGGGCACTTCAAGGTGACCTAC
GATGTCAGTCGAGACAAGATCTGCGACCTCCTGGTGGCCAATAACCACTTTGCCCACTTC
TTTGCCCCCCAAAACCTGACAAACATGAACAAGAACGTGGTTTTTGTGATTGACATCAGT
GGCTCCATGAGAGGCCAGAAAGTGAAGCAGACCAAGGAGGCACTCCTTAAAATTCTGGGG
GACATGCAGCCAGGGGACTACTTTGACCTGGTTCTTTTTGGGACTCGAGTACAATCGTGG
AAGGGCTCGCTGGTGCAAGCATCTGAGGCCAACCTACAAGCAGCTCAAGACTTTGTGCGG
GGCTTTTCCCTGGATGAGGCCACAAACCTGAATGGAGGTTTGCTCCGGGGAATTGAGATC
TTGAACCAAGTTCAGGAAAGCCTCCCAGAACTCAGCAACCATGCCTCAATACTCATCATG
TTGACAGATGGCGATCCCACAGAGGGGGTGACGGACCGTTCCCAAATCCTCAAGAACGTC
CGCAACGCCATCCGGGGCAGGTTCCCGCTCTACAACCTGGGTTTCGGCCACAATGTGGAC
TTTAACTTTCTGGAGGTCATGTCCATGGAGAACAACGGACGGGCCCAGAGAATCTACGAG
GACCATGATGCCACCCAGCAGCTGCAGGGTTTCTACAGCCAGGTAGCCAAACCCCTGCTG
GTGGATGTGGATTTGCAGTACCCCCAGGATGCTGTCTTGGCCCTGACCCAGAACCACCAT
AAACAGTACTACGAAGGCTCAGAGATTGTGGTGGCCGGGCGCATTGCTGACAACAAACAG
AGCAGCTTCAAGGCTGATGTGCAGGCCCATGGGGAGGGACAAGAATTCAGTATAACCTGC
CTAGTGGATGAGGAGGAGATGAAGAAACTGCTCCGAGAGCGTGGCCACATGCTGGAGAAC
CACGTCGAGCGCCTCTGGGCCTACCTCACCATCCAGGAGCTGCTGGCCAAGCGGATGAAG
GTGGACAGGGAGGAGAGGGCCAACCTGTCATCCCAGGCCCTGCAGATGTCGCTGGACTAT
GGGTTTGTGACCCCACTGACCTCCATGAGCATCAGGGGCATGGCGGACCAGGACGGCCTG
AAGCCCACCATCGACAAGCCCTCAGAGGATTCTCCGCCTTTGGAGATGCTGGGACCCAGA
AGGACGTTCGTGCTGTCAGCCTTGCAGCCTTCTCCTACTCATTCCAGCTCCAATACCCAG
CGGCTGCCAGACCGAGTGACCGGCGTGGACACAGACCCTCACTTCATCATCCACGTGCCC
CAGAAAGAGGACACCCTGTGCTTCAACATCAATGAGGAGCCTGGTGTTATCCTGAGCCTG
GTACAGGACCCCAACACAGGCTTCTCAGTGAATGGACAGCTCATTGGCAACAAGGCCAGG
AGCCCTGGGCAGCATGACGGCACGTACTTCGGGCGGCTGGGAATCGCAAACCCTGCCACG
GACTTTCAGTTGGAAGTGACTCCTCAGAACATTACGCTGAACCCCGGCTTTGGTGGGCCT
GTGTTTTCCTGGAGGGACCAAGCTGTGCTGCGGCAGGACGGGGTGGTGGTGACCATCAAC
AAGAAGAGGAACCTGGTGGTGTCTGTGGACGACGGTGGCACCTTTGAGGTTGTTTTGCAC
CGAGTGTGGAAGGGGAGCTCGGTCCACCAGGACTTCCTGGGCTTCTATGTGCTGGACAGT
CATCGGATGTCAGCCCGGACGCACGGGCTGCTGGGGCAATTTTTCCACCCCATCGGTTTT
GAAGTGTCTGACATCCACCCAGGCTCTGACCCCACAAAGCCAGATGCCACGATGGTGGTG
AGGAACCGCCGGCTCACGGTCACCAGGGGTTTGCAAAAAGACTACAGCAAGGACCCGTGG
CATGGGGCCGAGGTGTCCTGCTGGTTCATTCACAACAATGGGGCTGGACTCATCGATGGT
GCCTACACTGATTATATCGTCCCCGACATCTTCTGA
Chromosome Location
3
Locus
3p21.1
External Identifiers
ResourceLink
UniProtKB IDP19827
UniProtKB Entry NameITIH1_HUMAN
HGNC IDHGNC:6166
General References
  1. Diarra-Mehrpour M, Bourguignon J, Bost F, Sesboue R, Muschio F, Sarafan N, Martin JP: Human inter-alpha-trypsin inhibitor: full-length cDNA sequence of the heavy chain H1. Biochim Biophys Acta. 1992 Aug 17;1132(1):114-8. [PubMed:1380832]
  2. Bost F, Bourguignon J, Martin JP, Sesboue R, Thiberville L, Diarra-Mehrpour M: Isolation and characterization of the human inter-alpha-trypsin inhibitor heavy-chain H1 gene. Eur J Biochem. 1993 Dec 1;218(2):283-91. [PubMed:7505744]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Malki N, Balduyck M, Maes P, Capon C, Mizon C, Han KK, Tartar A, Fournet B, Mizon J: The heavy chains of human plasma inter-alpha-trypsin inhibitor: their isolation, their identification by electrophoresis and partial sequencing. Differential reactivity with concanavalin A. Biol Chem Hoppe Seyler. 1992 Oct;373(10):1009-18. [PubMed:1384548]
  7. Enghild JJ, Thogersen IB, Pizzo SV, Salvesen G: Analysis of inter-alpha-trypsin inhibitor and a novel trypsin inhibitor, pre-alpha-trypsin inhibitor, from human plasma. Polypeptide chain stoichiometry and assembly by glycan. J Biol Chem. 1989 Sep 25;264(27):15975-81. [PubMed:2476436]
  8. Gebhard W, Schreitmuller T, Hochstrasser K, Wachter E: Two out of the three kinds of subunits of inter-alpha-trypsin inhibitor are structurally related. Eur J Biochem. 1989 May 15;181(3):571-6. [PubMed:2471637]
  9. Huang L, Yoneda M, Kimata K: A serum-derived hyaluronan-associated protein (SHAP) is the heavy chain of the inter alpha-trypsin inhibitor. J Biol Chem. 1993 Dec 15;268(35):26725-30. [PubMed:7504674]
  10. Salier JP, Diarra-Mehrpour M, Sesboue R, Bourguignon J, Benarous R, Ohkubo I, Kurachi S, Kurachi K, Martin JP: Isolation and characterization of cDNAs encoding the heavy chain of human inter-alpha-trypsin inhibitor (I alpha TI): unambiguous evidence for multipolypeptide chain structure of I alpha TI. Proc Natl Acad Sci U S A. 1987 Dec;84(23):8272-6. [PubMed:2446322]
  11. Schreitmuller T, Hochstrasser K, Reisinger PW, Wachter E, Gebhard W: cDNA cloning of human inter-alpha-trypsin inhibitor discloses three different proteins. Biol Chem Hoppe Seyler. 1987 Aug;368(8):963-70. [PubMed:3663330]
  12. Morelle W, Capon C, Balduyck M, Sautiere P, Kouach M, Michalski C, Fournet B, Mizon J: Chondroitin sulphate covalently cross-links the three polypeptide chains of inter-alpha-trypsin inhibitor. Eur J Biochem. 1994 Apr 15;221(2):881-8. [PubMed:7513643]
  13. Diarra-Mehrpour M, Bourguignon J, Sarafan N, Bost F, Sesboue R, Muschio-Bonnet F, Martin JP: Tandem orientation of the inter-alpha-trypsin inhibitor heavy chain H1 and H3 genes. Biochim Biophys Acta. 1994 Oct 18;1219(2):551-4. [PubMed:7522574]
  14. Flahaut C, Capon C, Balduyck M, Ricart G, Sautiere P, Mizon J: Glycosylation pattern of human inter-alpha-inhibitor heavy chains. Biochem J. 1998 Aug 1;333 ( Pt 3):749-56. [PubMed:9677337]
  15. Olsen EH, Rahbek-Nielsen H, Thogersen IB, Roepstorff P, Enghild JJ: Posttranslational modifications of human inter-alpha-inhibitor: identification of glycans and disulfide bridges in heavy chains 1 and 2. Biochemistry. 1998 Jan 6;37(1):408-16. [PubMed:9425062]
  16. Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. [PubMed:12754519]
  17. Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65. [PubMed:14760718]
  18. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  19. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218]
  20. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. [PubMed:19139490]
  21. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  22. Ding M, Umetsu K, Yuasa I, Sato M, Harada A, Suzuki T: Molecular basis of inter-alpha-trypsin inhibitor heavy chain H1 (ITIH1) polymorphism. Hum Genet. 1995 Apr;95(4):435-6. [PubMed:7535743]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01593Zincapproved, investigationalunknownDetails
DB09338MersalylexperimentalunknowninducerDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails