50S ribosomal protein L2
Details
- Name
- 50S ribosomal protein L2
- Synonyms
- Hl4
- Hmal2
- Gene Name
- rpl2
- Organism
- Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
- Amino acid sequence
>lcl|BSEQ0020802|50S ribosomal protein L2 MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVE FEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFA RASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKM KARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
- Number of residues
- 240
- Molecular Weight
- 25308.485
- Theoretical pI
- Not Available
- GO Classification
- FunctionsrRNA binding / structural constituent of ribosomeProcessestranslationComponentslarge ribosomal subunit
- General Function
- Structural constituent of ribosome
- Specific Function
- One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome (By similarity).
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0020803|50S ribosomal protein L2 (rpl2) ATGGGACGACGAATCCAAGGACAACGGCGCGGCCGCGGGACCTCCACGTTCCGTGCTCCG TCGCACCGTTACAAGGCTGATCTGGAGCACCGCAAGGTCGAGGACGGCGACGTCATCGCC GGCACGGTCGTCGACATTGAGCACGACCCTGCCCGCTCGGCTCCGGTCGCTGCCGTCGAG TTCGAAGACGGCGACCGACGACTTATCCTCGCGCCGGAAGGCGTCGGGGTAGGCGACGAG CTACAGGTCGGCGTCAGCGCCGAGATCGCACCCGGGAACACGCTCCCGCTGGCCGAGATC CCAGAGGGGGTCCCGGTGTGCAACGTCGAATCCAGCCCCGGTGACGGTGGGAAGTTCGCC CGCGCGTCGGGTGTCAACGCCCAGCTGCTCACCCACGACCGCAACGTCGCGGTCGTCAAG CTCCCCTCCGGGGAGATGAAGCGGCTTGACCCGCAGTGTCGTGCTACCATCGGCGTCGTC GCCGGTGGCGGCCGAACTGACAAGCCGTTCGTGAAGGCTGGCAACAAGCATCACAAGATG AAAGCGCGAGGGACGAAGTGGCCCAACGTCCGCGGTGTGGCGATGAACGCCGTCGACCAC CCGTTCGGTGGTGGCGGACGCCAGCACCCCGGCAAGCCCAAGTCCATCTCGCGGAACGCC CCGCCTGGCCGTAAGGTCGGGGACATCGCCTCGAAGCGAACAGGTCGAGGTGGCAACGAA TGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P20276 UniProtKB Entry Name RL2_HALMA - General References
- Arndt E, Kromer W, Hatakeyama T: Organization and nucleotide sequence of a gene cluster coding for eight ribosomal proteins in the archaebacterium Halobacterium marismortui. J Biol Chem. 1990 Feb 25;265(6):3034-9. [Article]
- Baliga NS, Bonneau R, Facciotti MT, Pan M, Glusman G, Deutsch EW, Shannon P, Chiu Y, Weng RS, Gan RR, Hung P, Date SV, Marcotte E, Hood L, Ng WV: Genome sequence of Haloarcula marismortui: a halophilic archaeon from the Dead Sea. Genome Res. 2004 Nov;14(11):2221-34. [Article]
- Uhlein M, Weglohner W, Urlaub H, Wittmann-Liebold B: Functional implications of ribosomal protein L2 in protein biosynthesis as shown by in vivo replacement studies. Biochem J. 1998 Apr 15;331 ( Pt 2):423-30. [Article]
- Ban N, Nissen P, Hansen J, Capel M, Moore PB, Steitz TA: Placement of protein and RNA structures into a 5 A-resolution map of the 50S ribosomal subunit. Nature. 1999 Aug 26;400(6747):841-7. [Article]
- Ban N, Nissen P, Hansen J, Moore PB, Steitz TA: The complete atomic structure of the large ribosomal subunit at 2.4 A resolution. Science. 2000 Aug 11;289(5481):905-20. [Article]
- Nissen P, Hansen J, Ban N, Moore PB, Steitz TA: The structural basis of ribosome activity in peptide bond synthesis. Science. 2000 Aug 11;289(5481):920-30. [Article]
- Schmeing TM, Seila AC, Hansen JL, Freeborn B, Soukup JK, Scaringe SA, Strobel SA, Moore PB, Steitz TA: A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits. Nat Struct Biol. 2002 Mar;9(3):225-30. [Article]
- Klein DJ, Schmeing TM, Moore PB, Steitz TA: The kink-turn: a new RNA secondary structure motif. EMBO J. 2001 Aug 1;20(15):4214-21. [Article]
- Hansen JL, Ippolito JA, Ban N, Nissen P, Moore PB, Steitz TA: The structures of four macrolide antibiotics bound to the large ribosomal subunit. Mol Cell. 2002 Jul;10(1):117-28. [Article]
- Hansen JL, Schmeing TM, Moore PB, Steitz TA: Structural insights into peptide bond formation. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11670-5. Epub 2002 Aug 16. [Article]
- Hansen JL, Moore PB, Steitz TA: Structures of five antibiotics bound at the peptidyl transferase center of the large ribosomal subunit. J Mol Biol. 2003 Jul 25;330(5):1061-75. [Article]
- Schmeing TM, Moore PB, Steitz TA: Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit. RNA. 2003 Nov;9(11):1345-52. [Article]
- Gabdulkhakov A, Nikonov S, Garber M: Revisiting the Haloarcula marismortui 50S ribosomal subunit model. Acta Crystallogr D Biol Crystallogr. 2013 Jun;69(Pt 6):997-1004. doi: 10.1107/S0907444913004745. Epub 2013 May 11. [Article]