Muscarinic acetylcholine receptor M3

Details

Name
Muscarinic acetylcholine receptor M3
Synonyms
Not Available
Gene Name
CHRM3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0009898|Muscarinic acetylcholine receptor M3
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
Number of residues
590
Molecular Weight
66127.445
Theoretical pI
9.62
GO Classification
Functions
acetylcholine binding / drug binding / G-protein coupled acetylcholine receptor activity / phosphatidylinositol phospholipase C activity / receptor activity
Processes
adenylate cyclase-inhibiting G-protein coupled acetylcholine receptor signaling pathway / cell proliferation / cellular protein modification process / energy reserve metabolic process / G-protein coupled acetylcholine receptor signaling pathway / G-protein coupled receptor signaling pathway / nervous system development / phospholipase C-activating G-protein coupled acetylcholine receptor signaling pathway / positive regulation of smooth muscle contraction / regulation of insulin secretion / regulation of vascular smooth muscle contraction / saliva secretion / sensory perception of chemical stimulus / signal transduction / small molecule metabolic process / smooth muscle contraction / synaptic transmission, cholinergic
Components
asymmetric synapse / axon terminus / basolateral plasma membrane / cell junction / dendrite / integral component of plasma membrane / plasma membrane / postsynaptic membrane / synapse
General Function
Receptor activity
Specific Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Pfam Domain Function
Transmembrane Regions
68-91 105-130 143-164 185-206 230-252 492-514 527-546
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0009899|Muscarinic acetylcholine receptor M3 (CHRM3)
ATGACCTTGCACAATAACAGTACAACCTCGCCTTTGTTTCCAAACATCAGCTCCTCCTGG
ATACACAGCCCCTCCGATGCAGGGCTGCCCCCGGGAACCGTCACTCATTTCGGCAGCTAC
AATGTTTCTCGAGCAGCTGGCAATTTCTCCTCTCCAGACGGTACCACCGATGACCCTCTG
GGAGGTCATACCGTCTGGCAAGTGGTCTTCATCGCTTTCTTAACGGGCATCCTGGCCTTG
GTGACCATCATCGGCAACATCCTGGTAATTGTGTCATTTAAGGTCAACAAGCAGCTGAAG
ACGGTCAACAACTACTTCCTCTTAAGCCTGGCCTGTGCCGATCTGATTATCGGGGTCATT
TCAATGAATCTGTTTACGACCTACATCATCATGAATCGATGGGCCTTAGGGAACTTGGCC
TGTGACCTCTGGCTTGCCATTGACTACGTAGCCAGCAATGCCTCTGTTATGAATCTTCTG
GTCATCAGCTTTGACAGATACTTTTCCATCACGAGGCCGCTCACGTACCGAGCCAAACGA
ACAACAAAGAGAGCCGGTGTGATGATCGGTCTGGCTTGGGTCATCTCCTTTGTCCTTTGG
GCTCCTGCCATCTTGTTCTGGCAATACTTTGTTGGAAAGAGAACTGTGCCTCCGGGAGAG
TGCTTCATTCAGTTCCTCAGTGAGCCCACCATTACTTTTGGCACAGCCATCGCTGCTTTT
TATATGCCTGTCACCATTATGACTATTTTATACTGGAGGATCTATAAGGAAACTGAAAAG
CGTACCAAAGAGCTTGCTGGCCTGCAAGCCTCTGGGACAGAGGCAGAGACAGAAAACTTT
GTCCACCCCACGGGCAGTTCTCGAAGCTGCAGCAGTTACGAACTTCAACAGCAAAGCATG
AAACGCTCCAACAGGAGGAAGTATGGCCGCTGCCACTTCTGGTTCACAACCAAGAGCTGG
AAACCCAGCTCCGAGCAGATGGACCAAGACCACAGCAGCAGTGACAGTTGGAACAACAAT
GATGCTGCTGCCTCCCTGGAGAACTCCGCCTCCTCCGACGAGGAGGACATTGGCTCCGAG
ACGAGAGCCATCTACTCCATCGTGCTCAAGCTTCCGGGTCACAGCACCATCCTCAACTCC
ACCAAGTTACCCTCATCGGACAACCTGCAGGTGCCTGAGGAGGAGCTGGGGATGGTGGAC
TTGGAGAGGAAAGCCGACAAGCTGCAGGCCCAGAAGAGCGTGGACGATGGAGGCAGTTTT
CCAAAAAGCTTCTCCAAGCTTCCCATCCAGCTAGAGTCAGCCGTGGACACAGCTAAGACT
TCTGACGTCAACTCCTCAGTGGGTAAGAGCACGGCCACTCTACCTCTGTCCTTCAAGGAA
GCCACTCTGGCCAAGAGGTTTGCTCTGAAGACCAGAAGTCAGATCACTAAGCGGAAAAGG
ATGTCCCTGGTCAAGGAGAAGAAAGCGGCCCAGACCCTCAGTGCGATCTTGCTTGCCTTC
ATCATCACTTGGACCCCATACAACATCATGGTTCTGGTGAACACCTTTTGTGACAGCTGC
ATACCCAAAACCTTTTGGAATCTGGGCTACTGGCTGTGCTACATCAACAGCACCGTGAAC
CCCGTGTGCTATGCTCTGTGCAACAAAACATTCAGAACCACTTTCAAGATGCTGCTGCTG
TGCCAGTGTGACAAAAAAAAGAGGCGCAAGCAGCAGTACCAGCAGAGACAGTCGGTCATT
TTTCACAAGCGCGCACCCGAGCAGGCCTTGTAG
Chromosome Location
1
Locus
1q43
External Identifiers
ResourceLink
UniProtKB IDP20309
UniProtKB Entry NameACM3_HUMAN
GenBank Protein ID32324
GenBank Gene IDX15266
GenAtlas IDCHRM3
HGNC IDHGNC:1952
General References
  1. Peralta EG, Ashkenazi A, Winslow JW, Smith DH, Ramachandran J, Capon DJ: Distinct primary structures, ligand-binding properties and tissue-specific expression of four human muscarinic acetylcholine receptors. EMBO J. 1987 Dec 20;6(13):3923-9. [PubMed:3443095]
  2. Bonner TI, Young AC, Brann MR, Buckley NJ: Cloning and expression of the human and rat m5 muscarinic acetylcholine receptor genes. Neuron. 1988 Jul;1(5):403-10. [PubMed:3272174]
  3. Kitano T, Liu YH, Ueda S, Saitou N: Human-specific amino acid changes found in 103 protein-coding genes. Mol Biol Evol. 2004 May;21(5):936-44. Epub 2004 Mar 10. [PubMed:15014171]
  4. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Speek M: Antisense promoter of human L1 retrotransposon drives transcription of adjacent cellular genes. Mol Cell Biol. 2001 Mar;21(6):1973-85. [PubMed:11238933]
  7. Yang J, Williams JA, Yule DI, Logsdon CD: Mutation of carboxyl-terminal threonine residues in human m3 muscarinic acetylcholine receptor modulates the extent of sequestration and desensitization. Mol Pharmacol. 1995 Sep;48(3):477-85. [PubMed:7565628]
  8. Weber S, Thiele H, Mir S, Toliat MR, Sozeri B, Reutter H, Draaken M, Ludwig M, Altmuller J, Frommolt P, Stuart HM, Ranjzad P, Hanley NA, Jennings R, Newman WG, Wilcox DT, Thiel U, Schlingmann KP, Beetz R, Hoyer PF, Konrad M, Schaefer F, Nurnberg P, Woolf AS: Muscarinic Acetylcholine Receptor M3 Mutation Causes Urinary Bladder Disease and a Prune-Belly-like Syndrome. Am J Hum Genet. 2011 Nov 11;89(5):668-74. doi: 10.1016/j.ajhg.2011.10.007. [PubMed:22077972]
  9. Patowary S, Alvarez-Curto E, Xu TR, Holz JD, Oliver JA, Milligan G, Raicu V: The muscarinic M3 acetylcholine receptor exists as two differently sized complexes at the plasma membrane. Biochem J. 2013 Jun 1;452(2):303-12. doi: 10.1042/BJ20121902. [PubMed:23521066]
  10. Iverson HA, Fox D 3rd, Nadler LS, Klevit RE, Nathanson NM: Identification and structural determination of the M(3) muscarinic acetylcholine receptor basolateral sorting signal. J Biol Chem. 2005 Jul 1;280(26):24568-75. Epub 2005 May 2. [PubMed:15870063]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00496Darifenacinapproved, investigationalyesantagonistDetails
DB00729Diphemanil methylsulfateapproved, vet_approved, withdrawnyesantagonistDetails
DB00777PropiomazineapprovedunknownantagonistDetails
DB00185CevimelineapprovedyesagonistDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB00340MetixeneapprovedunknownantagonistDetails
DB00383OxyphencyclimineapprovedyesantagonistDetails
DB00420Promazineapproved, vet_approvedunknownantagonistDetails
DB00505TridihexethylwithdrawnyesantagonistDetails
DB00517Anisotropine methylbromideapprovedyesantagonistDetails
DB00572Atropineapproved, vet_approvedyesantagonistDetails
DB00725Homatropine MethylbromideapprovedyesantagonistDetails
DB00767BenzquinamidewithdrawnyesantagonistDetails
DB00785CryptenamineapprovedyesantagonistDetails
DB01069Promethazineapproved, investigationalunknownantagonistDetails
DB01231Diphenidolapproved, investigational, withdrawnyesantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB01409TiotropiumapprovedyesantagonistDetails
DB01591SolifenacinapprovedyesantagonistDetails
DB01062Oxybutyninapproved, investigationalyesantagonistDetails
DB01036Tolterodineapproved, investigationalyesantagonistDetails
DB05752ALKS 27investigationalunknownDetails
DB00332IpratropiumapprovedyesantagonistDetails
DB00622Nicardipineapproved, investigationalunknownantagonistDetails
DB06702FesoterodineapprovedyesantagonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB00246ZiprasidoneapprovednoantagonistDetails
DB00363ClozapineapprovednoantagonistDetails
DB01238Aripiprazoleapproved, investigationalnoantagonistDetails
DB01338PipecuroniumapprovedunknownantagonistDetails
DB01337PancuroniumapprovedunknownantagonistDetails
DB00280DisopyramideapprovedunknownantagonistDetails
DB00342Terfenadineapproved, withdrawnunknownantagonistDetails
DB00424HyoscyamineapprovedunknownantagonistDetails
DB01239Chlorprothixeneexperimental, investigational, withdrawnnoantagonistDetails
DB01142Doxepinapproved, investigationalyesantagonistDetails
DB00321AmitriptylineapprovednoantagonistDetails
DB01151Desipramineapproved, investigationalnoantagonistDetails
DB00458ImipramineapprovednoantagonistDetails
DB00540NortriptylineapprovednoantagonistDetails
DB00715Paroxetineapproved, investigationalnoantagonistDetails
DB00434CyproheptadineapprovedunknownantagonistDetails
DB00835BrompheniramineapprovedunknownantagonistDetails
DB00809Tropicamideapproved, investigationalunknownantagonistDetails
DB00747Scopolamineapproved, investigationalunknownantagonistDetails
DB00387ProcyclidineapprovedyesantagonistDetails
DB00376TrihexyphenidylapprovedunknownantagonistDetails
DB01226MivacuriumapprovednoantagonistDetails
DB01085Pilocarpineapproved, investigationalyesagonistDetails
DB00202SuccinylcholineapprovedunknownagonistDetails
DB00934Maprotilineapproved, investigationalnoantagonistDetails
DB04843MepenzolateapprovedyesantagonistDetails
DB01625Isopropamideapproved, vet_approvedyesantagonistDetails
DB06709Methacholineapproved, investigationalyesagonistDetails
DB00193Tramadolapproved, investigationalunknownantagonistDetails
DB00462Methscopolamine bromideapprovedunknownantagonistDetails
DB08897AclidiniumapprovedyesantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknownantagonistDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00986Glycopyrroniumapproved, investigational, vet_approvedunknownantagonistDetails
DB09076UmeclidiniumapprovedyesantagonistDetails
DB06787HexocycliumapprovedyesantagonistDetails
DB09300Butylscopolamineapproved, investigational, vet_approvedyesantagonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB09262ImidafenacininvestigationalyesantagonistDetails
DB03128Acetylcholineapproved, investigationalunknownDetails
DB00599Thiopentalapproved, vet_approvedunknownDetails
DB00411CarbamoylcholineapprovedunknownDetails
DB04365ArecolineexperimentalunknownDetails
DB01019BethanecholapprovedunknownDetails
DB11181HomatropineapprovedyesantagonistDetails
DB06153PizotifenapprovedunknownantagonistDetails
DB12278Propiverineapproved, investigationalyesantagonistDetails
DB11235ThonzylamineapprovedunknownantagonistDetails
DB09089TrimebutineapprovedyesantagonistDetails
DB14185Aripiprazole lauroxilapproved, investigationalnoDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00726TrimipramineapprovedunknownbinderDetails
DB00454MeperidineapprovedunknownbinderDetails
DB00568Cinnarizineapproved, investigationalunknownbinderDetails
DB01221Ketamineapproved, vet_approvedunknownbinderDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB11855Revefenacinapproved, investigationalyesantagonistDetails